Protein Info for Dsui_1837 in Dechlorosoma suillum PS

Annotation: cation/cationic drug transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 108 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details transmembrane" amino acids 32 to 50 (19 residues), see Phobius details amino acids 57 to 78 (22 residues), see Phobius details amino acids 84 to 103 (20 residues), see Phobius details PF00893: Multi_Drug_Res" amino acids 1 to 93 (93 residues), 108.5 bits, see alignment E=1e-35

Best Hits

Swiss-Prot: 61% identical to QACF_KLEAE: Quaternary ammonium compound-resistance protein QacF (qacF) from Klebsiella aerogenes

KEGG orthology group: K03297, small multidrug resistance protein, SMR family (inferred from 74% identity to aaa:Acav_4639)

MetaCyc: 50% identical to DLP12 prophage; multidrug/betaine/choline efflux transporter EmrE (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-344; TRANS-RXN0-493; TRANS-RXN0-532; TRANS-RXN0-533; TRANS-RXN0-628

Predicted SEED Role

"Ethidium bromide-methyl viologen resistance protein EmrE"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QGS7 at UniProt or InterPro

Protein Sequence (108 amino acids)

>Dsui_1837 cation/cationic drug transporter (Dechlorosoma suillum PS)
MHWLHLAIAIVAEVIATSALKAAAGFTRPLPSLVVVAGYGLAFYFLSLTLRVIPMGVAYA
VWSAVGIALVSLIGWLVYDQRLDAPALLGMGLIVAGVAVIQLFSRTAH