Protein Info for Dsui_1833 in Dechlorosoma suillum PS

Annotation: nitrate transport ATP-binding subunits C and D

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 266 PF00005: ABC_tran" amino acids 24 to 166 (143 residues), 123.6 bits, see alignment E=9.2e-40 TIGR01184: nitrate ABC transporter, ATP-binding proteins C and D" amino acids 24 to 254 (231 residues), 355.7 bits, see alignment E=5.4e-111

Best Hits

Swiss-Prot: 66% identical to NASD_KLEOX: Nitrate transport protein NasD (nasD) from Klebsiella oxytoca

KEGG orthology group: K02049, sulfonate/nitrate/taurine transport system ATP-binding protein (inferred from 83% identity to dar:Daro_0832)

Predicted SEED Role

"Nitrate ABC transporter, ATP-binding protein" in subsystem Nitrate and nitrite ammonification

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QGS3 at UniProt or InterPro

Protein Sequence (266 amino acids)

>Dsui_1833 nitrate transport ATP-binding subunits C and D (Dechlorosoma suillum PS)
MEKFVQIEAVGQTFDTKKGKFVALRDVDLSIRQGEFIALIGHSGCGKSTLLNLIAGLTRP
TDGALICDGREIAGPGPERGVVFQNHSLLPWLTCFDNVYLAVERVFAAKEGKAKLKQRTH
DALALVGLTHAETKFPHEISGGMKQRVGIARALSMQPKVLLMDEPFGALDALTRAKLQDE
LMKICDATQATVVMVTHDVDEAVLLSDRIVMMTNGPAATIGEILSVDLPRPRNRLALAND
PKYIAARAAVLEFLYEKQAHKEVLAA