Protein Info for Dsui_1831 in Dechlorosoma suillum PS

Annotation: ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 425 signal peptide" amino acids 21 to 24 (4 residues), see Phobius details transmembrane" amino acids 25 to 43 (19 residues), see Phobius details PF13379: NMT1_2" amino acids 50 to 300 (251 residues), 361.7 bits, see alignment E=1.4e-112

Best Hits

KEGG orthology group: K02051, sulfonate/nitrate/taurine transport system substrate-binding protein (inferred from 76% identity to dar:Daro_0830)

Predicted SEED Role

"Nitrate ABC transporter, nitrate-binding protein" in subsystem Nitrate and nitrite ammonification

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QGS1 at UniProt or InterPro

Protein Sequence (425 amino acids)

>Dsui_1831 ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic component (Dechlorosoma suillum PS)
MSKQKQFEAPDAVAAERREFVKSAGLLGLGAALMGLTPGLRAAAFAAGSDAPEKTEVKIG
FIPLTDCASVVMAAAKGFDKKYGIKIVPTKEASWAAVRDKLVNGELDAAHVLYGLIYGVH
LGIGGPKKDMASLMTLNNNGQGITLSSQLKDKGVTDGAALKKLISSEKREFTFAQTFPTG
THAMWLYYWLAAHDINPMKDVKTITVPPPQMVANMRVGNMDGYCVGEPWNARAIIDKVGF
TAATTQDIWTDHPEKVLGTTADWAAKHPKTAVAVTAAILEASRWIDASLANRRETAETIA
AKAYVNTDVDVILDRMLGRYSNGIGKTWDDKNHMKFFNDGQVNFPYLSDGMWFLTQHRRW
GLLKDDPDYLGVAKAINQVGLYRQAAEKAGVAVPKSDLRSSKLIDGVVWDGKDPKKYAAS
FKVRA