Protein Info for Dsui_1824 in Dechlorosoma suillum PS

Annotation: PAS domain S-box/diguanylate cyclase (GGDEF) domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 649 transmembrane" amino acids 20 to 38 (19 residues), see Phobius details amino acids 198 to 217 (20 residues), see Phobius details amino acids 312 to 333 (22 residues), see Phobius details PF22588: dCache_1_like" amino acids 214 to 295 (82 residues), 39.1 bits, see alignment E=2.2e-13 TIGR00229: PAS domain S-box protein" amino acids 347 to 469 (123 residues), 72.4 bits, see alignment E=3.7e-24 PF00989: PAS" amino acids 352 to 458 (107 residues), 28.9 bits, see alignment E=2.9e-10 PF13188: PAS_8" amino acids 352 to 400 (49 residues), 26.7 bits, see alignment 1.2e-09 PF08448: PAS_4" amino acids 358 to 463 (106 residues), 39.8 bits, see alignment E=1.4e-13 PF13426: PAS_9" amino acids 362 to 461 (100 residues), 37.2 bits, see alignment E=9.2e-13 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 469 to 632 (164 residues), 157.8 bits, see alignment E=2e-50 PF00990: GGDEF" amino acids 473 to 629 (157 residues), 176.1 bits, see alignment E=1.4e-55

Best Hits

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QGR4 at UniProt or InterPro

Protein Sequence (649 amino acids)

>Dsui_1824 PAS domain S-box/diguanylate cyclase (GGDEF) domain-containing protein (Dechlorosoma suillum PS)
MAPENSTAPPNRPPLVRPGRSLLVGWLLLVAIIIGLVFREIGETRERLYNAAWDNLSTLN
LALLEQMERAITATDQALLNARQEVAAMPPLVAEKNPARREEQARREEQARRLHQLLRSQ
VTATPFVTNLVLVDAQGNVLAHSARHPVPAMNVREREYFRRLRDTAEAEPLISPPTRTLL
DGSQRLIFSRRLVGPRGHFAGVILASVSLADVVSFYRSVLHLPGGAVALYHSNTTLLARY
PEMPDSLGHAYPEQDLFLRTPGRGASGTLLETSSMDGRQRLKSFREAKRYPILVSVSQEE
SELLRPWRATTLHIILMGLGSIVLCSLFIGLIWRQLQRLEEQARALRESEGRFRNLVERA
GDALFLHDPGGRIEDVNQQACDSLGLPREELIGSNMDAFEVGIPAAELHQLWHNLDTNAP
VTQEGRHRHRLGHEFPVEMRIGAFASGGRRLILTLARDVTERQAYQEKLRQQALHDGLTG
LPNRVLFNDLLGQLLAQSERQERAFALLFVDLDHFKEVNDTLGHAAGDRLLQEAAARLRG
CLRKADTVARLGGDEFAVLLAEVAGAEDAEQVAEKIVAAMNRPFPLPNGEGHVSASIGIA
LYPEAGKDAETLLRHADWAMYQAKSGGRNGYRRYRHVVGETTLGQGLGL