Protein Info for Dsui_1775 in Dechlorosoma suillum PS

Annotation: type I secretion membrane fusion protein, HlyD family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 469 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details transmembrane" amino acids 48 to 67 (20 residues), see Phobius details TIGR01843: type I secretion membrane fusion protein, HlyD family" amino acids 44 to 469 (426 residues), 354.5 bits, see alignment E=4.2e-110 PF25917: BSH_RND" amino acids 92 to 346 (255 residues), 29.7 bits, see alignment E=7.2e-11 PF25994: HH_AprE" amino acids 121 to 310 (190 residues), 156.8 bits, see alignment E=1.1e-49 PF26002: Beta-barrel_AprE" amino acids 353 to 446 (94 residues), 85.5 bits, see alignment E=3.4e-28

Best Hits

KEGG orthology group: K02022, (no description) (inferred from 58% identity to vei:Veis_1643)

Predicted SEED Role

"ABC exporter for hemopore HasA, membrane fusion protein (MFP) family component HasE" in subsystem Protein secretion by ABC-type exporters

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QG87 at UniProt or InterPro

Protein Sequence (469 amino acids)

>Dsui_1775 type I secretion membrane fusion protein, HlyD family (Dechlorosoma suillum PS)
MNTLLRLKVFMSLGSLLLRLKTTVTSLLPPPPLADDALPTDTERPLRIGIWGLAIGFGGL
LLWATLAPLDEGVPTQGVVSIDTKRKTIQHLLGGRIREVYVKEGQYVQANELLLKLEDAN
ARANYEAVRQHYLSLRSVEGRLLAEQSGATKISFHEDILKYADDPLVRQQMATQEQLLQS
RRLAYEAEQQAMREAIRGQEAQVTGYGGMIESRRNQLRLLEKELKSISDLVKQGFMARTR
QLELERNAAEVSSILADLNGNLIKSRQGIAEVKMRLIQRQQEYRKEVDTLLADVQRDVQV
DEDKLRAVTEELEHTEIRSPVAGQVVGLVTQTVGGVVQAAQRLMDIVPVDEPLLLEAKVP
PHLIDRIKVGLPTDVRFTTFAHSPQLLVEGTIQSISADLITENQPSSGQPTSYYLVRISI
SPEGMKKLGNRNLQPGMAAEVVIKTGERSVLTYLLHPLTKRIAASMKEE