Protein Info for Dsui_1772 in Dechlorosoma suillum PS

Annotation: type I secretion system ABC transporter, PrtD family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 579 transmembrane" amino acids 22 to 44 (23 residues), see Phobius details amino acids 56 to 79 (24 residues), see Phobius details amino acids 128 to 151 (24 residues), see Phobius details amino acids 156 to 174 (19 residues), see Phobius details amino acids 254 to 269 (16 residues), see Phobius details amino acids 271 to 287 (17 residues), see Phobius details TIGR01842: type I secretion system ATPase" amino acids 21 to 558 (538 residues), 626.4 bits, see alignment E=2.1e-192 PF00664: ABC_membrane" amino acids 26 to 272 (247 residues), 28.4 bits, see alignment E=1.4e-10 PF00005: ABC_tran" amino acids 350 to 497 (148 residues), 102.1 bits, see alignment E=4e-33

Best Hits

Swiss-Prot: 45% identical to APRD_PSEAE: Alkaline protease secretion ATP-binding protein AprD (aprD) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: None (inferred from 55% identity to pph:Ppha_0378)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QG84 at UniProt or InterPro

Protein Sequence (579 amino acids)

>Dsui_1772 type I secretion system ABC transporter, PrtD family (Dechlorosoma suillum PS)
MNAAGKRTSELWRIFGQLGGSFRQAFFFSCFINILALAPVAYMMQVYDRVIYSRNFTTLV
MLTGLVLGLYVLTVVLDYVRAEIMLQAGLKLEALLGDRLFNLVFDASLRRLPGGAVHSLS
DLRTLRDFLVSPALMAALDVPVSLLFLLLIYSINPVLGHFSVIGALIQFVLTYVQERRTD
PPLKQAGSAMMEAQGYAHGVLRNAQVIQAMGMLSHLHERWMVRQRRFLRLQAIASDHAGK
GMTLAKVVQIGQGSLLLGLGCWLTLKGLMSGGGSAMIVATILGGRVVQPLVQLTSMWKIV
VGARDAFDRLEKVLHDLPAKPASMRLPAPQGHLTVEGVVAAAPGGGAPILKGLNFKVSPG
EILAIIGPSAAGKTSLARVLMGVWPAAVGKVRLDGVDIYQWNKTELGPHLGYLPQDVELF
EGTLAENIARFGDVDMEQVEAAARVVGLHENIADLPEGYDSQVGSDGCFLSGGQRQRVAL
ARAIYGNPKLVVLDEPNASLDEAGDLALAQALEMLKARGVAVVVISHLTSVLRVVDSLLV
IQEGAVKLYGKRDEVLAVLYPQSIKGKAVPAPASGGSGA