Protein Info for Dsui_1769 in Dechlorosoma suillum PS

Annotation: putative PLP-dependent enzyme possibly involved in cell wall biogenesis

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 376 PF01041: DegT_DnrJ_EryC1" amino acids 17 to 360 (344 residues), 400.7 bits, see alignment E=6.7e-124 PF00266: Aminotran_5" amino acids 53 to 162 (110 residues), 22.3 bits, see alignment E=6.1e-09

Best Hits

Swiss-Prot: 55% identical to DESV_STRVZ: dTDP-3-amino-3,4,6-trideoxy-alpha-D-glucose transaminase (desV) from Streptomyces venezuelae

KEGG orthology group: None (inferred from 76% identity to app:CAP2UW1_1352)

MetaCyc: 55% identical to dTDP-3-oxo-3,4,6-trideoxy-alpha-D-glucopyranose transaminase monomer (Streptomyces venezuelae)
RXN-12768 [EC: 2.6.1.106]

Predicted SEED Role

"Aminotransferase"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.6.1.106

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QG81 at UniProt or InterPro

Protein Sequence (376 amino acids)

>Dsui_1769 putative PLP-dependent enzyme possibly involved in cell wall biogenesis (Dechlorosoma suillum PS)
MIPFLDLKELNRSLAPELHTALTRVLDSGWLVLGQEVEAFEAEFAAYCQTDYCIGVANGL
EALHLILRAYDIGAGDEVIVPANTFIATWLAVTYAGARLVPVEPLLNTGNMDPQAVAAAI
TPRTKAIMPVHLYGQTAEMAPLMDLAERHGLKVIEDAAQAHGATCHGRRAGSLGHAAGFS
FYPGKNLGALGDGGAITTSDPQLAERLRLLRNYGSRSKYRNEEAGFNCRLDEIQAAFLRA
KLPLLDGWNQRRRQIAARYDAELGAAGLQLMQEAPGHVSARHLYVVRSPQRDALQVALHE
AGVQTAIHYPVPPHLQPAYAGLGYREGAFPITEILHREVLSLPMGPTLDDSQVTAVIDAV
KAVSARMQPAPAGPLA