Protein Info for Dsui_1760 in Dechlorosoma suillum PS

Annotation: putative O-linked N-acetylglucosamine transferase, SPINDLY family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 625 PF13432: TPR_16" amino acids 10 to 61 (52 residues), 31.2 bits, see alignment 1.4e-10 amino acids 48 to 100 (53 residues), 18.4 bits, see alignment 1.5e-06 amino acids 118 to 173 (56 residues), 16.9 bits, see alignment 4.3e-06 PF14559: TPR_19" amino acids 17 to 71 (55 residues), 27.3 bits, see alignment 2.3e-09 amino acids 48 to 108 (61 residues), 28.4 bits, see alignment 1e-09 PF13181: TPR_8" amino acids 72 to 105 (34 residues), 21.6 bits, see alignment (E = 1e-07) PF00515: TPR_1" amino acids 73 to 105 (33 residues), 29.2 bits, see alignment (E = 3.6e-10) PF07719: TPR_2" amino acids 73 to 105 (33 residues), 24.8 bits, see alignment (E = 9.5e-09) PF13844: Glyco_transf_41" amino acids 251 to 404 (154 residues), 125.4 bits, see alignment E=1.3e-39 amino acids 415 to 602 (188 residues), 153.1 bits, see alignment E=5.3e-48

Best Hits

KEGG orthology group: None (inferred from 70% identity to lch:Lcho_1755)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QG72 at UniProt or InterPro

Protein Sequence (625 amino acids)

>Dsui_1760 putative O-linked N-acetylglucosamine transferase, SPINDLY family (Dechlorosoma suillum PS)
MNAPNTLLIQAIELQNQGRLDEALALFNICLQNNPNDAAALYSVGVILLKQGKAAQAIPL
LEHGVAVAPQFAPLWFVLGAVRQALGQKEEALQAYDKALEVRPDYTEVLINSGALLRELM
RHQEALERFNRVLTYDPNHQLALGNCGILLTEFKRSTEAVGMFQRLLAINPNYDYGYGLL
SYERLHACDWTDFAALREAIVAGVRAGRRACKSLAFMALSDSAEDHQRCARTFSQHHYPK
AEPLWRGERYRHERIRVAYVSPDLREHPVGHLIAGVLERHDKSRFETVAISLGINDQSRL
RGRMEKAFDHFIDAKQMGTRKIAELMREMEIDIAVDLAGFTADSRTDVFAYRPAPVQVNY
LGYPGTLGLDYMDYILADRFVIPPEHQCFYDEKVVYLPDAYLPTDSGVKISERTPSRSEC
GLPEQGVVFCSFSHDYKVSPPVFDIWMNLLRQVPGSVLWLVSRNEVSQGNLRKEAQARGV
DPSRLVFAGRVPLVEDHLARYRQADIFLDTHPYNAHTTAADALMAGLPVVTYMGNAFPAR
VAGSLVHAVGLPELATKSLAEYEALALALATDPARLAALKARLQANLATQPLFDTDAFCR
NLEAAYIAMWRRSQLGGAEDALCGT