Protein Info for Dsui_1759 in Dechlorosoma suillum PS

Annotation: flagellar hook-basal body complex protein FliE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00205: flagellar hook-basal body complex protein FliE
  • amino acids 4 to 107 (104 residues), 96.8 bits, E=5.1e-32
• PF02049: FliE
  • amino acids 21 to 107 (87 residues), 107.8 bits, E=1.3e-35

Best Hits

Swiss-Prot: 52% identical to FLIE_NITEU: Flagellar hook-basal body complex protein FliE (fliE) from Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)

KEGG orthology group: K02408, flagellar hook-basal body complex protein FliE (inferred from 67% identity to dar:Daro_0776)

Predicted SEED Role

"Flagellar hook-basal body complex protein FliE" in subsystem Flagellum or Flagellum in Campylobacter

Sequence Analysis Tools

See G8QG71 at UniProt or InterPro

Protein Sequence (107 amino acids)

>Dsui_1759 flagellar hook-basal body complex protein FliE (Dechlorosoma suillum PS)
MDTKGIDNLLSQLRSTAGTAAAKSVDNAAASAGGADFAQVLKNSIDQVNSAQQQAQSMAQ
DFSAGDSNTNLHEVMIALQKANVSFQEMVQVRNKLVSAYQDVMNIQV