Protein Info for Dsui_1757 in Dechlorosoma suillum PS

Annotation: signal transduction histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 401 transmembrane" amino acids 75 to 92 (18 residues), see Phobius details PF13188: PAS_8" amino acids 71 to 117 (47 residues), 28.8 bits, see alignment 1.2e-10 PF00512: HisKA" amino acids 176 to 240 (65 residues), 52.9 bits, see alignment E=4.8e-18 PF02518: HATPase_c" amino acids 287 to 391 (105 residues), 84.1 bits, see alignment E=1.4e-27

Best Hits

Predicted SEED Role

"Flagellar sensor histidine kinase FleS" in subsystem Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QG69 at UniProt or InterPro

Protein Sequence (401 amino acids)

>Dsui_1757 signal transduction histidine kinase (Dechlorosoma suillum PS)
MSPSLPEPVQERPDAKAQELQKAFDVFNQVSQELTQAYDALQGRVASLTAELAVANGELR
RQYKEKEALSERLSLLLNALPAGVVVLDSAFLVTEANPAAKAMFGQDLVGEGWSRVSGQA
LVPTGAPDEWQVGSRRVSIAKSPLDSAGGQILLVHDITHAHEMKANLERNQRLAAMGEMA
ASLAHQLRTPLATALLYSSNLGKPELAPEARTRFADKATEQLKRLERLIQDVLLFARGES
IGREAIPVAALVTEAVQAVEPLMKRHGVDFRVEAEVGDFIMMGARKAIAGALTNLLENAL
QVVEGRTERPPRVLLQARVSEGRCYIAVSDTGPGIAPEAQARIFEPFFTTRGQGTGLGLA
IALGVARAHGGTISVRSQPGEGSEFTLELPAGPASQFVVES