Protein Info for Dsui_1744 in Dechlorosoma suillum PS

Annotation: flagellar biosynthetic protein FliR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 261 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 44 to 62 (19 residues), see Phobius details amino acids 68 to 88 (21 residues), see Phobius details amino acids 91 to 114 (24 residues), see Phobius details amino acids 121 to 171 (51 residues), see Phobius details amino acids 180 to 204 (25 residues), see Phobius details amino acids 214 to 237 (24 residues), see Phobius details TIGR01400: flagellar biosynthetic protein FliR" amino acids 14 to 255 (242 residues), 222 bits, see alignment E=4.5e-70 PF01311: Bac_export_1" amino acids 14 to 247 (234 residues), 222 bits, see alignment E=4.1e-70

Best Hits

Swiss-Prot: 39% identical to FLIR_ECOLI: Flagellar biosynthetic protein FliR (fliR) from Escherichia coli (strain K12)

KEGG orthology group: K02421, flagellar biosynthetic protein FliR (inferred from 54% identity to app:CAP2UW1_3812)

Predicted SEED Role

"Flagellar biosynthesis protein FliR" in subsystem Flagellar motility or Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QG56 at UniProt or InterPro

Protein Sequence (261 amino acids)

>Dsui_1744 flagellar biosynthetic protein FliR (Dechlorosoma suillum PS)
MISVTSAELNAWIAAFIFPLVRILAFVAAAPVFNNAAVPRRVRLILGLALSAAIIPAVPA
LPPIEPASGIGLAILAQQILIGIALATVMRFVFAGIGLAGELMSFQMGLGFATLYDPQST
AQTGVVAEVVTLCATMVFLALNGHLLMIAGLVESFQSIPIATPSVSAGLWLNLAEAGAKV
FSIGLLLSLPVVIALMITNLALSILSKAAPQLNLMAVGFPITLTIGLGTLALTLPYMVPP
LTRIFDEGFRLMLEVFVPIKP