Protein Info for Dsui_1738 in Dechlorosoma suillum PS

Annotation: flagellar basal body L-ring protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 221 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF02107: FlgH" amino acids 42 to 220 (179 residues), 194.7 bits, see alignment E=4.9e-62

Best Hits

Swiss-Prot: 61% identical to FLGH_DECAR: Flagellar L-ring protein (flgH) from Dechloromonas aromatica (strain RCB)

KEGG orthology group: K02393, flagellar L-ring protein precursor FlgH (inferred from 65% identity to app:CAP2UW1_3818)

Predicted SEED Role

"Flagellar L-ring protein FlgH" in subsystem Flagellar motility or Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QG50 at UniProt or InterPro

Protein Sequence (221 amino acids)

>Dsui_1738 flagellar basal body L-ring protein (Dechlorosoma suillum PS)
MKLSLPFIIGLLTLLSGCASVPPTNVHQPMTARPQPRNDLATNNGGIFMQTASRPLFEDR
RARFVGDTIVVNIVENTQASIKGNTSAEKTGAINASVTALAGVPGKSFQGLNAQTSSSNT
FDGKGESGSSNVFTGTMTATVIEVLPNGNLLVSGEKQVAIGQGQEFVRVSGVVNPYMITA
ANAVNSSQMADARIEYKSSGIINEAQVMGWLARFFLTFIPF