Protein Info for Dsui_1736 in Dechlorosoma suillum PS

Annotation: flagellar basal-body rod protein FlgF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 247 TIGR03506: flagellar hook-basal body protein" amino acids 4 to 121 (118 residues), 116.6 bits, see alignment E=2.1e-37 TIGR02490: flagellar basal-body rod protein FlgF" amino acids 5 to 223 (219 residues), 182.7 bits, see alignment E=7.4e-58 PF22692: LlgE_F_G_D1" amino acids 81 to 146 (66 residues), 62.2 bits, see alignment E=4.2e-21 PF06429: Flg_bbr_C" amino acids 200 to 241 (42 residues), 59.1 bits, see alignment 2.4e-20

Best Hits

KEGG orthology group: K02391, flagellar basal-body rod protein FlgF (inferred from 71% identity to dar:Daro_0753)

Predicted SEED Role

"Flagellar basal-body rod protein FlgF" in subsystem Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QG48 at UniProt or InterPro

Protein Sequence (247 amino acids)

>Dsui_1736 flagellar basal-body rod protein FlgF (Dechlorosoma suillum PS)
MDRLIYTSMTGAKHAFMRQAGVAHNLANAATSGYRSQEHHFRAVPVQGEGFATRTFTVDA
SVKDVMDQGPMMYTGRSLDVAVQGKGWIAVQGADGKEAYTRAGSLDVNANGQLQTKDGQN
VLGEGGPISIPPDSSISVAPDGTISVVPTFGVPNTTNIVARMKLVNPPEDQLERGADGLF
RQKNGQPANLDANVRLAPETLEGSNVNVVDAMVNMISIARQFDMQMKMLQNADANAKAAG
QLLTAAR