Protein Info for Dsui_1717 in Dechlorosoma suillum PS

Annotation: chemotaxis signal transduction protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 322 PF01584: CheW" amino acids 36 to 162 (127 residues), 107.8 bits, see alignment E=3.5e-35 PF00072: Response_reg" amino acids 185 to 306 (122 residues), 45.9 bits, see alignment E=5.9e-16

Best Hits

KEGG orthology group: K03415, two-component system, chemotaxis family, response regulator CheV (inferred from 81% identity to dar:Daro_0734)

Predicted SEED Role

"Chemotaxis protein CheV (EC 2.7.3.-)" in subsystem Bacterial Chemotaxis or Flagellar motility (EC 2.7.3.-)

Isozymes

Compare fitness of predicted isozymes for: 2.7.3.-

Use Curated BLAST to search for 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QG29 at UniProt or InterPro

Protein Sequence (322 amino acids)

>Dsui_1717 chemotaxis signal transduction protein (Dechlorosoma suillum PS)
MSELLKSIDARTKLAGTNKLEILLFTLGTDSRNGRRETFGINVFKVREVMRTPPITAAPD
MPAAVEGMVSLRGALVPVVDLAKYAGVQTDTPRDIMIVTEYNGHTQGFLVEAVDTILRLD
WGMMRVPPEMLVAQMGGLVTAVTELADGRLVMMMDVEKVLSETTKYDDEFMYRSIVPIDK
PECTVFFADDSVVARKQIERTLQAMNVKYVAAINGRQAWEELEKMAAYAVSLGRPVNEMV
SLVLTDIEMPEMDGYILTKKVKSDPRFAGVPVIMHSSLSGMSNQKLGQSVGVDEYVPKFE
PQKLSETLARRLGATLPATVEA