Protein Info for Dsui_1692 in Dechlorosoma suillum PS

Annotation: periplasmic chaperone LolA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 210 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details TIGR00547: outer membrane lipoprotein carrier protein LolA" amino acids 10 to 207 (198 residues), 75.9 bits, see alignment E=1.5e-25 PF03548: LolA" amino acids 36 to 200 (165 residues), 159.3 bits, see alignment E=3.6e-51

Best Hits

Swiss-Prot: 60% identical to LOLA_DECAR: Outer-membrane lipoprotein carrier protein (lolA) from Dechloromonas aromatica (strain RCB)

KEGG orthology group: K03634, outer membrane lipoprotein carrier protein (inferred from 67% identity to app:CAP2UW1_2296)

Predicted SEED Role

"Outer membrane lipoprotein carrier protein LolA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QFL3 at UniProt or InterPro

Protein Sequence (210 amino acids)

>Dsui_1692 periplasmic chaperone LolA (Dechlorosoma suillum PS)
MKTPPKFLLAALLAAALLPGAAQASGVAKLKAFLDNTRSLRAEFVQSVVAKSGRKPQNSA
GLMMFQRPGKFRWQVEKPYPQLMVGDGEKFWIYDPELKQVTVKKMGKTLGATPAALLAGE
GSASLEKNFTLAEGGEKDGLEWAEATPRSADSGFEKVRLGFAGDNLRAMELHDSFGQTTA
LIFNRVERNPSLAPGLFRFTPPPGADVAGE