Protein Info for Dsui_1653 in Dechlorosoma suillum PS

Annotation: ferrous iron transporter FeoB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 666 transmembrane" amino acids 119 to 136 (18 residues), see Phobius details amino acids 306 to 334 (29 residues), see Phobius details amino acids 377 to 396 (20 residues), see Phobius details amino acids 422 to 443 (22 residues), see Phobius details amino acids 451 to 473 (23 residues), see Phobius details amino acids 479 to 499 (21 residues), see Phobius details amino acids 535 to 554 (20 residues), see Phobius details amino acids 608 to 632 (25 residues), see Phobius details amino acids 639 to 662 (24 residues), see Phobius details TIGR00231: small GTP-binding protein domain" amino acids 27 to 143 (117 residues), 45 bits, see alignment E=9.6e-16 PF02421: FeoB_N" amino acids 27 to 178 (152 residues), 160.1 bits, see alignment E=8e-51 PF01926: MMR_HSR1" amino acids 28 to 137 (110 residues), 63.6 bits, see alignment E=4.6e-21 TIGR00437: ferrous iron transport protein B" amino acids 32 to 634 (603 residues), 342 bits, see alignment E=7.8e-106 PF17910: FeoB_Cyto" amino acids 192 to 282 (91 residues), 34.2 bits, see alignment E=6.8e-12 PF07670: Gate" amino acids 382 to 474 (93 residues), 61 bits, see alignment E=3.4e-20 amino acids 538 to 637 (100 residues), 41.2 bits, see alignment E=5.1e-14 PF07664: FeoB_C" amino acids 482 to 531 (50 residues), 42.4 bits, see alignment 1.2e-14

Best Hits

Predicted SEED Role

"Ferrous iron transport protein B" in subsystem Campylobacter Iron Metabolism or Iron acquisition in Vibrio or Transport of Iron

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QFH4 at UniProt or InterPro

Protein Sequence (666 amino acids)

>Dsui_1653 ferrous iron transporter FeoB (Dechlorosoma suillum PS)
METSAESTRPSPLADNEAAAAAPAGLVVALVGHPNVGKSVLFHRLTGTYVNVSNYPGTTV
EVSRATLKIHKEQQVLDTPGVLSLPSRSDDERATLRALLQENLNCLVQVGDAKNLRRTLT
LTALLADLGVPMVLMLNMADEAEQRGIGVDDKLLAEALGIPVISGVATRNEGVGALEAAL
AKAARPEPLLCYDDAVESAIGRLAAQFASDVPHAHLSARGLAILYLGHDPELEAWLDQHF
PKTAALLAALRLNLEGEFTGQPLAALLSGERGRAAEALTRTVAREGKKPASGKPLTAGQL
AVHPVWGWPILLGVLFLLYEFVGVFGASTLVGLFEEDFFGGVLNPAFTELVQNHVSIPWI
VELLVGEYGLWTMGMTYALALILPIVTTFFFAFGILEDSGYLPRLTVIANRTFAAIGLNG
KAVLPMVLGLGCVTMATLTTRILATPRERLITTFLLALAIPCSAQLGVVLGLLGGVSFGA
LLTWAVCILVVLLSSGWLASRLIPGKRIPLMTELPPLRWPVLGNVLKKTGGRLKWYLVEV
IPLFLIGTFLMFALDKIGALPAIIEAGEPLVSGWLGLPKEASAAFVMGFLRRDFGATGLF
AMTEHLSAIQAVVGMVTITLFVPCIASVMMIVKEQGLKVAVVLLALIIPTAFLIGGILNH
LLRLFA