Protein Info for Dsui_1646 in Dechlorosoma suillum PS

Annotation: cAMP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 248 PF00027: cNMP_binding" amino acids 50 to 132 (83 residues), 55.7 bits, see alignment E=5.8e-19 PF13545: HTH_Crp_2" amino acids 168 to 242 (75 residues), 74.4 bits, see alignment E=8.7e-25 PF00325: Crp" amino acids 193 to 224 (32 residues), 47.9 bits, see alignment 1.3e-16

Best Hits

Swiss-Prot: 49% identical to BTR_BORPE: Transcriptional regulatory protein btr (btr) from Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)

KEGG orthology group: K01420, CRP/FNR family transcriptional regulator, anaerobic regulatory protein (inferred from 87% identity to dar:Daro_1047)

Predicted SEED Role

"cAMP-binding proteins - catabolite gene activator and regulatory subunit of cAMP-dependent protein kinases" in subsystem cAMP signaling in bacteria

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QFG7 at UniProt or InterPro

Protein Sequence (248 amino acids)

>Dsui_1646 cAMP-binding protein (Dechlorosoma suillum PS)
MPLKKTSAQEITLSVIKTACSNCNLQELCLPYGLNETEMSKLDELVSTRRKIKRGDHLYR
AGEAFESIYAIRAGFFKTDVLLEDGRDQVTGFQMAGELLGLDGISTEHHSCNAVALEDSE
VCIIPFPRLEGLSREIVALQHHFHKVMSREIVRDHGVMMLLGTMRAEERLAAFLLNLSQR
FTARGYSHAEFYLRMTREEIGSYLGLKLETVSRAFSRFQEEGLIAVQQKHIRILDIPGLK
KLMTHQSA