Protein Info for Dsui_1642 in Dechlorosoma suillum PS

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 432 signal peptide" amino acids 1 to 44 (44 residues), see Phobius details transmembrane" amino acids 53 to 76 (24 residues), see Phobius details amino acids 88 to 109 (22 residues), see Phobius details amino acids 115 to 138 (24 residues), see Phobius details amino acids 150 to 173 (24 residues), see Phobius details amino acids 187 to 211 (25 residues), see Phobius details amino acids 219 to 238 (20 residues), see Phobius details amino acids 248 to 269 (22 residues), see Phobius details amino acids 281 to 302 (22 residues), see Phobius details amino acids 314 to 343 (30 residues), see Phobius details amino acids 366 to 385 (20 residues), see Phobius details amino acids 391 to 412 (22 residues), see Phobius details

Best Hits

KEGG orthology group: None (inferred from 52% identity to app:CAP2UW1_2136)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QFG3 at UniProt or InterPro

Protein Sequence (432 amino acids)

>Dsui_1642 hypothetical protein (Dechlorosoma suillum PS)
MQAMLSFDQAPPLAAPLRFFLSAPLFAAAAGLLLLLLGPELLASRWTAGALAFTHLLTAG
FMLQTMVGALLQILPVATGAGVARPLGVARAVHGLLTLGLLFLVGAFLTYRSELFQGALL
CLGGGILIFLVAVGRALVQIPMGSTIQWALKLAVAGLGVTVLLGLSMLVNLAWGLSWPLL
EITGIHLAWGLVGWGVLLLSGVAYVVVPMFLLTPAFPGWLTRLLAPLLFLLLALWSGAEA
AGWGGAPLLAALVAAGCGTFALATLWLLVRSKRARLDATQRYWRLGLACAVGGAALWAVG
QLWPALGLWPGLPLLLGMLLLVGGFMSVITGMLYKIVPFLIWLHLQNAGQGRVLAPNMKR
ILAESAMARQMAAHAASLALLLAAVVRPAWFAWPAGLALLLSNLWLLVNLWRCLQVYRRH
LRHIGEQLATAA