Protein Info for Dsui_1625 in Dechlorosoma suillum PS

Annotation: copper/silver-translocating P-type ATPase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 813 transmembrane" amino acids 179 to 200 (22 residues), see Phobius details amino acids 212 to 233 (22 residues), see Phobius details amino acids 245 to 267 (23 residues), see Phobius details amino acids 273 to 291 (19 residues), see Phobius details amino acids 429 to 451 (23 residues), see Phobius details amino acids 457 to 483 (27 residues), see Phobius details amino acids 767 to 785 (19 residues), see Phobius details amino acids 789 to 808 (20 residues), see Phobius details PF12156: ATPase-cat_bd" amino acids 5 to 87 (83 residues), 92.1 bits, see alignment E=7.8e-30 PF00403: HMA" amino acids 98 to 156 (59 residues), 43.4 bits, see alignment 9.4e-15 TIGR01511: copper-translocating P-type ATPase" amino acids 229 to 810 (582 residues), 494.9 bits, see alignment E=6.9e-152 TIGR01525: heavy metal translocating P-type ATPase" amino acids 247 to 809 (563 residues), 535.5 bits, see alignment E=3.7e-164 PF00122: E1-E2_ATPase" amino acids 322 to 413 (92 residues), 94.6 bits, see alignment E=7.2e-31 TIGR01494: HAD ATPase, P-type, family IC" amino acids 330 to 787 (458 residues), 247.9 bits, see alignment E=3.2e-77 PF00702: Hydrolase" amino acids 508 to 720 (213 residues), 102.8 bits, see alignment E=8.3e-33

Best Hits

KEGG orthology group: K01533, Cu2+-exporting ATPase [EC: 3.6.3.4] (inferred from 64% identity to azo:azo1339)

Predicted SEED Role

"Type cbb3 cytochrome oxidase biogenesis protein CcoI; Copper-translocating P-type ATPase (EC 3.6.3.4)" (EC 3.6.3.4)

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.4

Use Curated BLAST to search for 3.6.3.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QPV3 at UniProt or InterPro

Protein Sequence (813 amino acids)

>Dsui_1625 copper/silver-translocating P-type ATPase (Dechlorosoma suillum PS)
MSKGACYHCGQPVPDDVDLTVRVSESPRAMCCIGCQAVAQAIVDNGLDDYYRNRDALPES
KREALPEVLDNLRLFDHADFQKSFVRALGENEREASLILEGITCAACIWLNEQHISHLPG
VAGVDINYTTRRARVRWDESKIKLSDILAAISAIGYRAYPYDPARTEELARKERRDALWR
VWVAGFGMMQVMMYAIPVYMAEGDMTADIESLMRWASLLLTLPVVFYSAAPFFRNAWRDL
KFRRVGMDVPVALGVGSAFAASIWATFVADGEVYFDSVTMFVFFLLGGRFLEMNARQRAV
GVTEALAKLLPAFAERLVAYPQDRTPGKVVVADLRAGDVVLVRPGGTIPSDGRVLEGTSS
VNESLLTGESLPVSKRVGDTVTGGAINVESPLVVRVEQVGEGTRLSAIVRLMERAAMEKP
RIVEMADRIASRFVAALLLVAAAVALAWWFIDPARALWITVSVLVVTCPCALSLATPIAL
TVASGVLAREGLLVTRGHAIETLARSTHVVFDKTGTLTSGRMRLLEVLPLGTVGAEDGLR
LAGALEGASEHPIAQVFRSKAAQLAAWPHGTEVVTSIPGSGISGVLGGVEYRIGRPDFVA
ELVGAALPDSARGFAARGDTVIALGAASGWIALFALGDEIRAEAPALVADLLASGRQVVL
LSGDAPEAAARVAALLGIQDVHGGVSPQGKHDFVSRLQEAGAVVAMVGDGVNDAPVLAQA
QVSVAMGGGAQLARTQADLILLSENLDHLRRGIALSGKALRIIRQNLVWSFAYNFIALPL
AMFGFITPWMAGIGMSGSSLLVVLNSLRLQRPL