Protein Info for Dsui_1620 in Dechlorosoma suillum PS

Annotation: PAP2 (acid phosphatase) superfamily protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 255 transmembrane" amino acids 23 to 42 (20 residues), see Phobius details amino acids 81 to 98 (18 residues), see Phobius details amino acids 110 to 129 (20 residues), see Phobius details amino acids 159 to 182 (24 residues), see Phobius details amino acids 193 to 212 (20 residues), see Phobius details amino acids 220 to 240 (21 residues), see Phobius details PF01569: PAP2" amino acids 111 to 236 (126 residues), 58 bits, see alignment E=4.2e-20

Best Hits

KEGG orthology group: None (inferred from 55% identity to tmz:Tmz1t_1932)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QPU9 at UniProt or InterPro

Protein Sequence (255 amino acids)

>Dsui_1620 PAP2 (acid phosphatase) superfamily protein (Dechlorosoma suillum PS)
MDNATSLPLPVAGVLERHAGRRWLLTQALLLALLAVLLLAVFENTDLDLALSQRLYDPAL
GDFPMHHHWLFERVLHHGMKYASYALVCIALVPCWLGWKGELDWLPRRNALLAALGMVLI
PIGVSLLKSLTNRHCPWDVLEFGGYAPYLGLLVPGPTDIKAGACFPAGHAAAGFLWLVWG
VALRPAGRTWSRLALALGLVFGAGLGVVRLFQGAHFLSHVLWSAWFAWALSLALAALLGA
DLRLRPGRGGQERVA