Protein Info for Dsui_1585 in Dechlorosoma suillum PS

Annotation: 4-hydroxythreonine-4-phosphate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 340 TIGR00557: 4-hydroxythreonine-4-phosphate dehydrogenase PdxA" amino acids 5 to 334 (330 residues), 415.4 bits, see alignment E=8.9e-129 PF04166: PdxA" amino acids 30 to 330 (301 residues), 358.4 bits, see alignment E=1.5e-111

Best Hits

KEGG orthology group: K00097, 4-hydroxythreonine-4-phosphate dehydrogenase [EC: 1.1.1.262] (inferred from 72% identity to dar:Daro_3657)

Predicted SEED Role

"4-hydroxythreonine-4-phosphate dehydrogenase (EC 1.1.1.262)" in subsystem Pyridoxin (Vitamin B6) Biosynthesis (EC 1.1.1.262)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.262

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QPR5 at UniProt or InterPro

Protein Sequence (340 amino acids)

>Dsui_1585 4-hydroxythreonine-4-phosphate dehydrogenase (Dechlorosoma suillum PS)
MRPTLAVTSGEPAGIGPELCLALSRYPAQARLVVLADKELLHQRAAQLGMDVPLHDYAPD
RPAPAGSLEVLHLPLAAPSAPGRLDAANGPYVLQLLDRALAGCLQGEFAAMVTAPLHKGV
INDAGIRGFTGHTEYLAEKTGTPLVVMMLAGTSPIGGHGPLGQPGPLRVALATTHLPLKE
VPAAITPAVLEDVLRILHADMARKYGIARPRILVAGLNPHAGEGGYLGREEIEVITPVLE
KLRREGMELLGPLPADTLFTPPQLARGDCVLAMYHDQGLAPLKFATFGQGINVTLGLPII
RTSVDHGTALDLAGTGQADPGSLFTAVEQAVEMARRSRPA