Protein Info for Dsui_1580 in Dechlorosoma suillum PS

Annotation: PAS domain S-box

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 901 transmembrane" amino acids 20 to 44 (25 residues), see Phobius details amino acids 263 to 282 (20 residues), see Phobius details TIGR00229: PAS domain S-box protein" amino acids 306 to 410 (105 residues), 60.4 bits, see alignment E=9.5e-21 amino acids 415 to 538 (124 residues), 88.4 bits, see alignment E=2.1e-29 amino acids 540 to 661 (122 residues), 26.8 bits, see alignment E=2.4e-10 PF00989: PAS" amino acids 308 to 364 (57 residues), 24.8 bits, see alignment 6.6e-09 amino acids 416 to 528 (113 residues), 53.9 bits, see alignment E=6e-18 PF13188: PAS_8" amino acids 309 to 348 (40 residues), 16.4 bits, see alignment (E = 2.5e-06) amino acids 422 to 470 (49 residues), 32.2 bits, see alignment 2.5e-11 amino acids 543 to 592 (50 residues), 24.3 bits, see alignment 8.1e-09 PF08448: PAS_4" amino acids 309 to 404 (96 residues), 50.3 bits, see alignment E=9.3e-17 amino acids 423 to 533 (111 residues), 61.5 bits, see alignment E=3e-20 PF13426: PAS_9" amino acids 312 to 402 (91 residues), 27.3 bits, see alignment E=1.3e-09 amino acids 431 to 530 (100 residues), 55.4 bits, see alignment E=2.3e-18 amino acids 556 to 655 (100 residues), 17.4 bits, see alignment E=1.5e-06 PF08447: PAS_3" amino acids 319 to 389 (71 residues), 45.1 bits, see alignment 3.6e-15 amino acids 437 to 524 (88 residues), 36.1 bits, see alignment E=2.3e-12 PF00512: HisKA" amino acids 679 to 747 (69 residues), 32.1 bits, see alignment 3.3e-11 PF02518: HATPase_c" amino acids 791 to 900 (110 residues), 75.6 bits, see alignment E=1.5e-24

Best Hits

KEGG orthology group: None (inferred from 55% identity to tmz:Tmz1t_3193)

Predicted SEED Role

"Chemotaxis regulator - transmits chemoreceptor signals to flagelllar motor components CheY" in subsystem Bacterial Chemotaxis or Flagellar motility or Two-component regulatory systems in Campylobacter

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QPR0 at UniProt or InterPro

Protein Sequence (901 amino acids)

>Dsui_1580 PAS domain S-box (Dechlorosoma suillum PS)
MPDRAEPASLPYKAAVARGGWYWLVPYLAIVLFALTMFALVGYIDKRDADERRAMVERDM
QWADQTLRLHLTANQDFLVQLGRNLADGVLDYEDFQIRAAQHLANNPELSVVLWVDPKGK
VQWVAPFEATEWVAGESLDPTQQDRLAEALRGGRPLYGSTYRNRQGAAYFDLTIPVQRWR
EDMGAIVGIYSTDGLLRHPVPTWFTEKYRLTLEDGEGKEVAANTAVRPTSKELAYRLTLE
PPANGLSLRAIAYATDDAWSRTLPPLVIGALTLALIWSLALLRRDVQRRLQAEKERDRLF
SLSLGLQCIATLEGKLRRVNPAFERVLGYPLGELRDRSLLDFVHPDDMALVVDMLRHLAE
GAAQEFECRFHSANGQDKWLLWSINPVPEEKLLYAVAHDITDRKTAEQALTDEYAFRKAM
EESVSTGLRAIDMEGRIIYVNPAFCRMLGWSEAELLGLKPPFPYWPPEHARQLATNIELT
LAGQAPAKGFEQRVMRKNGERMDVRFYISPLIDANGKQTGWMGAMTDITEPKRVRGELER
SQERFMAVLDGLDSAVYVADAKSDEILFGNRAFKSIFGFDAVGRNCWEVTEACRPPVGAF
DCDLRLLSPEVLPRQLFDGEVQNSLSGRWYHLHDRAIRWVDGRVVRVQIGTDITERKQIE
EVNLQQQKRLEQTSRLITMGEMASSLAHELNQPLAAIANYCMGCVKRMKGGAAKPEELLG
AMEKASFQAERAGKIIRRMREFVKKNEPNRGQVLLGDIVEEALGFAEIEARKLGVNICVD
LPPELPPLFADRIMIEQVLLNLVKNGIEAMRDTLPAERRLTVSATLPDNHSLEVAVADRG
HGLGSTTAEELFAPFYTTKPEGMGMGLPICRSIIEYHKGRLWADANPGGGTVFRFTLPLE
E