Protein Info for Dsui_1577 in Dechlorosoma suillum PS

Annotation: pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase, long form

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 555 PF00364: Biotin_lipoyl" amino acids 6 to 77 (72 residues), 73.8 bits, see alignment E=2.3e-24 amino acids 122 to 193 (72 residues), 76 bits, see alignment E=5e-25 TIGR01348: dihydrolipoyllysine-residue acetyltransferase" amino acids 97 to 555 (459 residues), 595 bits, see alignment E=8.1e-183 PF02817: E3_binding" amino acids 250 to 285 (36 residues), 52 bits, see alignment 2e-17 PF00198: 2-oxoacid_dh" amino acids 330 to 555 (226 residues), 263.6 bits, see alignment E=4.4e-82

Best Hits

Swiss-Prot: 69% identical to ODP2_CUPNH: Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex (pdhB) from Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337)

KEGG orthology group: K00627, pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC: 2.3.1.12] (inferred from 72% identity to azo:azo1372)

Predicted SEED Role

"Dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex (EC 2.3.1.12)" in subsystem Pyruvate metabolism II: acetyl-CoA, acetogenesis from pyruvate (EC 2.3.1.12)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QPQ7 at UniProt or InterPro

Protein Sequence (555 amino acids)

>Dsui_1577 pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase, long form (Dechlorosoma suillum PS)
MSQTIEVKVPDIGDFKDVPVIEIFVKPGDTVKVEDPLCSLESDKATMDVPSSAAGVVKEV
KIKVGDKVAEGSVVVILESAASGAAAAAPAPQAAAPAPVAAAPAAPAPVAAAPAPAASGP
VEVKVPDIGDFKDVPVIEVFVKVGDTVKQEDALCSLESDKATMDVPSSAAGVVKEVRVKV
GDKVSEGSVVVVLEGAAGAVAAVAAAPAAAAPAPAAPAVIPPELDGPAPTKPFTPAPAAA
PYGLALGGKVHASPSVRAFARELGVDLSKVTATGPKSRIQAEDVKAYIKGVMSGQTVAPT
QVGGGGITGGGSLDLLPWPKVDFAKFGPIEAKPLSRIKKISGANLARNWVMIPAVTYHED
ADITDLEAFRVQLNKENEKSGQKLTMLAFIIKACVKVLQQFPELNTSLDGDNLVYKKYYH
IGFAADTPNGLVVPVLKDADKKGVLEIAKETGELAKLARDGKLKPADMQGATFTISSVGG
IGGTAFSPIVNAPEVAILGVSKSSMKPVWNGKEFVPRLIVPLSLSADHRVIDGALATRFN
AELAKLLADFRRVML