Protein Info for Dsui_1576 in Dechlorosoma suillum PS

Annotation: dihydrolipoamide dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00364: Biotin_lipoyl
  • amino acids 6 to 76 (71 residues), 71.6 bits, E=1.9e-23
• TIGR01350: dihydrolipoyl dehydrogenase
  • amino acids 118 to 570 (453 residues), 486.3 bits, E=4.4e-150
• PF07992: Pyr_redox_2
  • amino acids 119 to 437 (319 residues), 216.2 bits, E=3.5e-67
• PF12831: FAD_oxidored
  • amino acids 119 to 156 (38 residues), 34.1 bits, 1e-11
• PF01134: GIDA
  • amino acids 119 to 181 (63 residues), 24.3 bits, E=7.9e-09
• PF00070: Pyr_redox
  • amino acids 289 to 364 (76 residues), 52 bits, E=4.2e-17
• PF02852: Pyr_redox_dim
  • amino acids 456 to 564 (109 residues), 112.4 bits, E=6.6e-36

Best Hits

Swiss-Prot: 63% identical to DLDH_ECOLI: Dihydrolipoyl dehydrogenase (lpdA) from Escherichia coli (strain K12)

KEGG orthology group: K00382, dihydrolipoamide dehydrogenase [EC: 1.8.1.4] (inferred from 75% identity to app:CAP2UW1_1840)

MetaCyc: 69% identical to dihydrolipoamide dehydrogenase (Advenella mimigardefordensis DPN7)
Dihydrolipoyl dehydrogenase. [EC: 1.8.1.4]; 1.8.1.- [EC: 1.8.1.4]

Predicted SEED Role

"Dihydrolipoamide dehydrogenase of pyruvate dehydrogenase complex (EC 1.8.1.4)" in subsystem Pyruvate metabolism II: acetyl-CoA, acetogenesis from pyruvate or TCA Cycle (EC 1.8.1.4)

MetaCyc Pathways

• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (18/22 steps found)
• 2-oxoglutarate decarboxylation to succinyl-CoA (3/3 steps found)
• glycine biosynthesis II (3/3 steps found)
• glycine cleavage (3/3 steps found)
• pyruvate decarboxylation to acetyl CoA I (3/3 steps found)
• 3,3'-disulfanediyldipropannoate degradation (2/4 steps found)
• 2-oxoisovalerate decarboxylation to isobutanoyl-CoA (1/3 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Citrate cycle (TCA cycle)
• Glycine, serine and threonine metabolism
• Glycolysis / Gluconeogenesis
• Pyruvate metabolism
• Valine, leucine and isoleucine degradation

Isozymes

Compare fitness of predicted isozymes for: 1.8.1.4

Use Curated BLAST to search for 1.8.1.4

Sequence Analysis Tools

See G8QPQ6 at UniProt or InterPro

Protein Sequence (581 amino acids)

>Dsui_1576 dihydrolipoamide dehydrogenase (Dechlorosoma suillum PS)
MSQLVEVKVPDIGDFKDVPVIEVFVKVGDTVKVEDPLVSLESDKATMDVPSSAAGVVKEI
KVKLGDKVAEGTVIVVVEAGAAAAAPAPQPAAPAAAPAPAAAPPPVAGSHGGGADVECDM
LVLGAGPGGYSAAFRSADLGLKTVLVERYPTLGGVCLNVGCIPSKALLHVAAVLEEAQHL
ADCGVTFAAPQVDVDKLRAHKEKVVGKLTGGLAGMAKGRKVQHVQGVGQFIDPHHIEVTA
ADGKKQVVKFKNAIIAAGSQPVALPFMPKDDPRVIDSTGALELRSVPKKMLVIGGGIIGL
EMATVYSALGTRITVVELGPGLMPGADRDLVKVWEKKNTQRFDRILLATGVTAAEAKAEG
IEVTYSTGEKEAFDLVLVAVGRTPNGKKIAADKAGVAVTDRGFINVDAQMRTNVPHIFAI
GDIVGQPMLAHKAVHEAHVAAEVAAGEKAAFDALQIPSVAYTHPEIAWAGKTEDQLKNDG
IKFEKAVFPWAASGRAIANGAEEGFTKLLFDAESHRLLGGGIVGMNAGDLIGEVCLAVEM
GCDAVDIGKTIHPHPTLCESIGMAAEVAHGSCTDLPPMKKK