Protein Info for Dsui_1564 in Dechlorosoma suillum PS

Annotation: PAS domain S-box/diguanylate cyclase (GGDEF) domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 100 200 300 400 500 600 700 800 900 1000 1100 1200 1281 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details transmembrane" amino acids 29 to 30 (2 residues), see Phobius details amino acids 296 to 317 (22 residues), see Phobius details PF00989: PAS" amino acids 355 to 455 (101 residues), 23.5 bits, see alignment E=1.8e-08 amino acids 730 to 823 (94 residues), 42.1 bits, see alignment 3.2e-14 PF08447: PAS_3" amino acids 366 to 451 (86 residues), 54.8 bits, see alignment 3.7e-18 amino acids 747 to 824 (78 residues), 28.8 bits, see alignment 4.8e-10 TIGR00229: PAS domain S-box protein" amino acids 369 to 464 (96 residues), 30 bits, see alignment 4.7e-11 amino acids 467 to 596 (130 residues), 30.9 bits, see alignment E=2.6e-11 amino acids 728 to 846 (119 residues), 73 bits, see alignment E=2.4e-24 PF08448: PAS_4" amino acids 373 to 459 (87 residues), 23.6 bits, see alignment 2.1e-08 amino acids 477 to 591 (115 residues), 28 bits, see alignment E=9.1e-10 amino acids 731 to 842 (112 residues), 31.4 bits, see alignment E=7.5e-11 PF13188: PAS_8" amino acids 471 to 519 (49 residues), 22.6 bits, see alignment (E = 3.1e-08) amino acids 602 to 643 (42 residues), 21.8 bits, see alignment (E = 5.4e-08) amino acids 728 to 770 (43 residues), 37 bits, see alignment (E = 8.6e-13) PF12860: PAS_7" amino acids 476 to 594 (119 residues), 105.4 bits, see alignment E=7.8e-34 amino acids 607 to 721 (115 residues), 103.8 bits, see alignment E=2.5e-33 PF13426: PAS_9" amino acids 482 to 588 (107 residues), 18.7 bits, see alignment E=7.2e-07 amino acids 735 to 839 (105 residues), 63.7 bits, see alignment E=6.9e-21 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 848 to 1010 (163 residues), 157.2 bits, see alignment E=3.2e-50 PF00990: GGDEF" amino acids 851 to 1008 (158 residues), 185.2 bits, see alignment E=3.2e-58 PF00563: EAL" amino acids 1028 to 1263 (236 residues), 268.5 bits, see alignment E=1.9e-83

Best Hits

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QPP4 at UniProt or InterPro

Protein Sequence (1281 amino acids)

>Dsui_1564 PAS domain S-box/diguanylate cyclase (GGDEF) domain-containing protein (Dechlorosoma suillum PS)
MSLRRETHLQATVVVVFFSLAVSLGLANIYLSHSEEAAVRVRTFQELRAVADLKAQQVAA
WRSERQAQAKSWQDSLHLERLLEAPGKAAELQANLQKSLGPLAELPENRAYLLLDDDGRV
RFSTAAPPQDSSVSEATRDLLKVAEYSDQPQLSDLQLDPQGHAFIDLAAVIRSPRSGQRL
AFLVQRIDPGAVLFPLIQARPVPSATAETLLLRQDESDFLVLNELRHRQDTALKLHLRRE
ESMLGAPATAAPQQEGVDYRRQLTLATSQQVADTPWILVTKVDAEEILSPVRQRNFLTYG
VSLLLLAGGGAFTLYLLRQQRKFFAERHEREQLAAEELQRTQDRLLEAQRIGHIGSWERD
LRSGRLWCSEEAYRLVGLDPSEPLTYAHFLELVHPEDRDKVQQATDHNAAKEETFAVEYR
VLLQDGRLRHFINRGRLFWDARGQPLRASGTTQDITERKLAEEEYRRQSTQLRAVLQNMP
QGISVFDEHLRLQLWNEGMREVLGLPAEALYRGVPFEDLVRYPAQRGEYGPGDPEQHVQE
RKALAMQFKPHRFERTRLDGRTTLVQGEPLFDDGQLTGFITTYTDISESKRNEQALRNQN
AILQNILENLPDGVSLYDPEQRMIACNERFRTLLDLPDTLFAQGYPTLEDMVRFNARRGE
YGPGDEERRTRGVLRALQRPNNTAVLRERPDGTVLEIRQVNLGDGSTIIIYTDITARHRA
EAELKLAEKVFANSPEAIMICDQGNRIISVNRAFCDITGYAQEEVLGQDPRMLASGRHDK
DFYRQMWEILRDTGAWAGEIWDRRKNGEIYPKWMTINAVHDTQSGALTHYITLFSDITER
KETEARIHHLAHHDPLTGLPNRFTLEARLEQSLADARRHGHKVAVMFMDLDRFKTINDSL
GHAVGDSLLMEIAHRLRSAVRESDTVARLGGDEFVVVLPDVEGANDAAHVAGKIIEDVAR
SLRVGAHELHTSASIGISLYPDDGETVPTVMQNADTAMYHAKAIGRNNFQFFASAMNRAA
TERLELERKLRQAMVNDELELHFQPQFALAADRVTGVEALLRWRHPEDGLIPPDRFIPIA
EETGLIVGIGDWVLQAACRQLKAWLDQGLPPLRMAVNLSTRQLKEKEFPSRVAAILQETG
LPAVLLELEITESGVMERPEEAITTLQALNDMGVTLAIDDFGTGYSSLSYLKLFPIDRLK
IDRSFVRDIERDPDDAAIARGTIALAHSLGLEVVAEGVETSAQLDMLAADGCDEVQGYFF
SRPLPLAAATAFLAQQAGRAG