Protein Info for Dsui_1560 in Dechlorosoma suillum PS

Annotation: glyceraldehyde-3-phosphate dehydrogenase, type I

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 342 PF00044: Gp_dh_N" amino acids 3 to 107 (105 residues), 122.6 bits, see alignment E=7.4e-40 TIGR01534: glyceraldehyde-3-phosphate dehydrogenase, type I" amino acids 4 to 333 (330 residues), 433.2 bits, see alignment E=3.4e-134 PF02800: Gp_dh_C" amino acids 161 to 321 (161 residues), 213 bits, see alignment E=1.8e-67

Best Hits

Swiss-Prot: 58% identical to G3P_RHOSH: Glyceraldehyde-3-phosphate dehydrogenase (gapB) from Rhodobacter sphaeroides

KEGG orthology group: K00134, glyceraldehyde 3-phosphate dehydrogenase [EC: 1.2.1.12] (inferred from 90% identity to tmz:Tmz1t_1496)

MetaCyc: 53% identical to Gap (Thermotoga maritima)
Glyceraldehyde-3-phosphate dehydrogenase (phosphorylating). [EC: 1.2.1.12]

Predicted SEED Role

"NAD-dependent glyceraldehyde-3-phosphate dehydrogenase (EC 1.2.1.12)" in subsystem Calvin-Benson cycle or Entner-Doudoroff Pathway or Glycolysis and Gluconeogenesis or Pyridoxin (Vitamin B6) Biosynthesis or Redox-dependent regulation of nucleus processes (EC 1.2.1.12)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.2.1.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QP96 at UniProt or InterPro

Protein Sequence (342 amino acids)

>Dsui_1560 glyceraldehyde-3-phosphate dehydrogenase, type I (Dechlorosoma suillum PS)
MAIKVAINGFGRIGRCTLRAIYEQGLQNEFDVVAINASGDLATNAHLLKYDTTHGRFGTS
VETEGENCIIIDGKKIPFYSTKNPKDIDWSKHGVEVLLECTGAYTTKEKAQALLQQGAKR
VLISAPGGDDVDTTIVMGVNEGVLKADMTVVSNASCTTNCLAPVAKVLAESVGIKQALMT
TVHAYTNDQVTVDVRHKDLRRARAAAANIIPTKTGAAKAVGLVLPQLAGKFDGFSLRVPT
INVSLVDLTFTAERATTKEEINELMTAAAKGPLKGIMAVNNEPLVSSDFNHTTVSSTFDA
TQTRVIKGADGSVLVKVLAWYDNEWGYSCRMLDAARAWMAAK