Protein Info for Dsui_1551 in Dechlorosoma suillum PS

Annotation: DNA mismatch repair protein MutL

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 618 TIGR00585: DNA mismatch repair protein MutL" amino acids 1 to 303 (303 residues), 305.6 bits, see alignment E=2.8e-95 PF02518: HATPase_c" amino acids 21 to 77 (57 residues), 34.4 bits, see alignment 5.1e-12 PF13589: HATPase_c_3" amino acids 24 to 118 (95 residues), 43.4 bits, see alignment E=7.3e-15 PF01119: DNA_mis_repair" amino acids 207 to 322 (116 residues), 131.2 bits, see alignment E=2.9e-42 PF08676: MutL_C" amino acids 432 to 572 (141 residues), 157.3 bits, see alignment E=4.3e-50

Best Hits

Predicted SEED Role

"DNA mismatch repair protein MutL" in subsystem DNA repair, bacterial MutL-MutS system

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QP87 at UniProt or InterPro

Protein Sequence (618 amino acids)

>Dsui_1551 DNA mismatch repair protein MutL (Dechlorosoma suillum PS)
MPIRLLPDLLISQIAAGEVVERPASVLKEVLENALDAGSQAIQIQLEEGGVKLIRVSDDG
CGIPQEELPLALTRHATSKIASLEDLEQVATLGFRGEALASVAAVARLTLTSRAAGAGHA
WKLAAHGSGEAEPAALAAGTVVEMRDLYYNTPARRKFLKSEGTEFAHCADAVKRVALAHP
GVAFSLAHNGRVSLSLPKADLAGRVGAILGQDFLAECRRVEAAINGLSIVGYAAQPAWSR
PGRDAQYVFVNGRFVRDKLLAHALREAYQDMLHGSRHPGYALFIEIDPAAVDVNVHPAKT
EVRFRDGRAVHQFVYHAVHKALSQVISDPSREVQTASPGLASLGGNAGAASGPVHADSGY
GQRSSAMPAWNPPRQGSLGVAEPSATSYLAFAAAARQGPGSGSTFPGGGSFAPAAAAADA
PGQEAPPLGYALAQLHGIYVLAQNARGLILVDMHAAHERILYEKLKSAYDSKAVPTQALL
IPAVFSASAHEVAAVEEHGATMAELGFELAPLGPNELALRSVPQLLAGGDPVNLARSLLA
ELMEHGASQVSTARRNELLATLACHGAVRARRLLTVPEMNALLRQMEETERADQCNHGRP
TWTELSLADLDKLFLRGQ