Protein Info for Dsui_1550 in Dechlorosoma suillum PS

Annotation: diguanylate cyclase (GGDEF) domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 572 PF00072: Response_reg" amino acids 13 to 115 (103 residues), 54.4 bits, see alignment E=2.1e-18 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 144 to 305 (162 residues), 55.9 bits, see alignment E=2.1e-19 PF00990: GGDEF" amino acids 149 to 301 (153 residues), 91.8 bits, see alignment E=6.3e-30 PF00563: EAL" amino acids 324 to 558 (235 residues), 248.2 bits, see alignment E=1.1e-77

Best Hits

KEGG orthology group: None (inferred from 36% identity to cyh:Cyan8802_0875)

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QP86 at UniProt or InterPro

Protein Sequence (572 amino acids)

>Dsui_1550 diguanylate cyclase (GGDEF) domain-containing protein (Dechlorosoma suillum PS)
MPVSPESALPLRVLFVDDSELDVELAARALRQSGHRIEWTRVETGAAMEEQLAQGGWDVV
ICDHNMPEFDSVSALALLQSRGGDLPFVIVSGMIPDDIAIEAMRRGARDFVSKDNLSRLA
PVVEREIREAGNRAALRQAQASLEHLLRFDPLTGIANVDFLLEHLEHRSAPEQAPFLLLL
VDINRFRKIMHGMGMVLANRVLRAVARRLSALIGEDDFVARASSDRFALVLSGIADPAGA
EAWFERLREAFAAGFSIQGQDLYLTCSIGAALHPRSADRENEGLDLMQHAEAALETAKRA
GPGQARLFHERMAQPEKGRLVLEAALYHALVNHEFVLHYQPQVDLATGRITGVEALLRWQ
SPERGLVSPLEFIPLLEETGLIVPVGEWVLGEACRQSVKWAQAGHHDLRVAVNLSALQFQ
QPRLAESVAMVIQRSGADPRNIELEITENIAMNQEEEVLDTLQQLRDIGVSLAIDDFGTG
YSSLSYLQQFPVNRLKIDQSFVRGPAAGSDLSIARAIVAMGTSLGLEVIAEGVETADQRS
RLQDCGCSEGQGYHFARPALPEDLAPALAQWR