Protein Info for Dsui_1542 in Dechlorosoma suillum PS

Annotation: small-conductance mechanosensitive channel

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 431 transmembrane" amino acids 20 to 38 (19 residues), see Phobius details amino acids 60 to 79 (20 residues), see Phobius details amino acids 85 to 108 (24 residues), see Phobius details amino acids 123 to 142 (20 residues), see Phobius details amino acids 163 to 185 (23 residues), see Phobius details amino acids 206 to 226 (21 residues), see Phobius details amino acids 233 to 260 (28 residues), see Phobius details PF21088: MS_channel_1st" amino acids 207 to 247 (41 residues), 29 bits, see alignment 1.3e-10 PF00924: MS_channel_2nd" amino acids 249 to 315 (67 residues), 54.3 bits, see alignment E=1.8e-18 PF21082: MS_channel_3rd" amino acids 324 to 407 (84 residues), 60.5 bits, see alignment E=2.6e-20

Best Hits

KEGG orthology group: None (inferred from 57% identity to dar:Daro_3158)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QP78 at UniProt or InterPro

Protein Sequence (431 amino acids)

>Dsui_1542 small-conductance mechanosensitive channel (Dechlorosoma suillum PS)
METLPQLFTDLWDDLQNPRIFWQMAVLLGCIGIAFFASRQVRNRIQTTPERWHAGRSGVK
RLLFPLLAAGLVVLARALLKPHMHVNLLTLAVPLMLSLAGIRLMVYILRQAFAPSGWLAA
SERVIATLVWLAAALHITGLDLPVIDAMEQVQFAVGKQRLDLWMILHGLVTIFVTVLGAL
WLAGLAEARLMGAQKLDSNVRAVLARIIKALLTLVAVLISLSLVGIDITTLSVFGGALGV
GLGFGLQKIASNYISGFIILLDRSIRLGDFIAIDAATSGVVTQITTRYTVLRGLAGTEYL
IPNEQFVANVVQNQSYTDTQVFLKTAVQVGYNSDVERAMAVLVEAAAAHPRVLQERAPRA
YLTGFADSGINLEVGFWIEDPEEGSGALRSDINLEIWKRFKAEGIEIPFPQREVRMLGEA
PTAAAESAARL