Protein Info for Dsui_1531 in Dechlorosoma suillum PS

Annotation: PAS domain S-box/diguanylate cyclase (GGDEF) domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 737 PF00989: PAS" amino acids 170 to 283 (114 residues), 50.6 bits, see alignment E=6.4e-17 TIGR00229: PAS domain S-box protein" amino acids 172 to 293 (122 residues), 78.8 bits, see alignment E=3.8e-26 PF13188: PAS_8" amino acids 172 to 222 (51 residues), 27.4 bits, see alignment 7.9e-10 PF13426: PAS_9" amino acids 179 to 285 (107 residues), 69.1 bits, see alignment E=1.3e-22 PF08448: PAS_4" amino acids 190 to 286 (97 residues), 26.5 bits, see alignment E=2.2e-09 PF08447: PAS_3" amino acids 194 to 272 (79 residues), 38.8 bits, see alignment E=3.2e-13 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 293 to 456 (164 residues), 144 bits, see alignment E=3.6e-46 PF00990: GGDEF" amino acids 297 to 454 (158 residues), 160.3 bits, see alignment E=1.3e-50 PF00563: EAL" amino acids 475 to 708 (234 residues), 260.6 bits, see alignment E=4.2e-81

Best Hits

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QP67 at UniProt or InterPro

Protein Sequence (737 amino acids)

>Dsui_1531 PAS domain S-box/diguanylate cyclase (GGDEF) domain-containing protein (Dechlorosoma suillum PS)
MSPQHPNEDVSDEDQLRRLLALLAHCHAAAGAAGSEADLAARICDSLTGCGGYSLACVGL
LENGSHRLVAARLGADAAADAMLPSDWQDLDRFPQFSAFAGSLSLPLEAGGKALGRLRIY
AAARALFSPEEHQLLRDIATLLALALAVRRCTSEAEAAARQDAGEALRLRDRAVESSSNG
IMITSATQLDHPITYVNPAFERITGYSAAEVQGRNGRFLVRDDLQQKGLNEIRAALRDRR
EGHAILRNYRKDGSLFWNELHLAPVLDESGQSTTHFVSVINDVSDRIHYQEQLEYQATHD
VLTGLANRSLLADRISQAIALARRDRRLVGVMLLDLDRFKVINDGLGHAPADKLLKTVAE
RLQTAVRDTDTVARLGGDEFVIVVGDILDADDVAVVAGKIQRALAQPLFVEGKELFVTAS
IGVSLFPRDGETGDILLRNADVAMYRVKEYGRNNYRFYLPEMSSMALDRLDMEGNLRRAL
ETDEFQVYYQPKVSLQQGTIVGAEALLRWMHPRIGQINPNEFIPLAEESGLIIPLGEKVI
ELVCRQIRAWREEGLPPLKVAINISARQFRQENLGETVRRLLEEYQVPGEMLDIELTESM
VMHDTDHAALTLRELKDLGVTLSLDDFGTGYSSLSYLKRFPIDCLKIDRSFVRDINSNAD
DAAIASAVIAMAHSLGLNVVAEGVETAEQLALLRQHGCDEFQGYFFSRAVPAGDYALLLR
QGKTLADAEAAPDGDLA