Protein Info for Dsui_1523 in Dechlorosoma suillum PS

Annotation: drug resistance transporter, EmrB/QacA subfamily

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 483 transmembrane" amino acids 21 to 45 (25 residues), see Phobius details amino acids 63 to 83 (21 residues), see Phobius details amino acids 91 to 110 (20 residues), see Phobius details amino acids 117 to 140 (24 residues), see Phobius details amino acids 150 to 171 (22 residues), see Phobius details amino acids 177 to 199 (23 residues), see Phobius details amino acids 211 to 231 (21 residues), see Phobius details amino acids 238 to 258 (21 residues), see Phobius details amino acids 278 to 300 (23 residues), see Phobius details amino acids 311 to 336 (26 residues), see Phobius details amino acids 348 to 370 (23 residues), see Phobius details amino acids 376 to 399 (24 residues), see Phobius details amino acids 414 to 433 (20 residues), see Phobius details amino acids 449 to 471 (23 residues), see Phobius details TIGR00711: drug resistance MFS transporter, drug:H+ antiporter-2 (14 Spanner) (DHA2) family" amino acids 25 to 434 (410 residues), 279 bits, see alignment E=3.7e-87 PF07690: MFS_1" amino acids 30 to 425 (396 residues), 174.4 bits, see alignment E=1.7e-55

Best Hits

Predicted SEED Role

"Multidrug resistance protein B"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QP59 at UniProt or InterPro

Protein Sequence (483 amino acids)

>Dsui_1523 drug resistance transporter, EmrB/QacA subfamily (Dechlorosoma suillum PS)
MSFSSSPRSLEALQARHGGRYPWLVLAAMACGMVTAVLSSTIFNVAIPSLMADFHLGQDR
VQWAVTGYMAAMTVAMLPTAWLIERYSFRRVFLGAVLLIGIGSLGGALAWNFPSVVAMRI
VQGLAAGLLQPMSTLLVLRLFPLERQGRAMGILGFGIILAPAVAPIAGGFLVDHFGWRAI
FLITVPGSLAALAAGHLLLPHKPAARAEHPFDWTGLSLLTLAILSLLQTVGGLHAHGLLS
TQSGVGALVAAAGIALFLRHARRVPGPILALGLFSERAFAMGTLVSFIFGVGLYGSTYLV
PVFLQSILGYNAATAGLALLPGGIALALMTPGAGYLADRIRPHRQTALGLLLFAISFVLL
ALLAGISLGLPLLPTLMGTVVIGRIGLALILPALNLGALRPLAQRLVGQGSALLNCTRQL
GGTLGISLGAVYVEWRSNHLGQPAGSAQAFAEVFALVALAFFLALGGALAMGKPATAATA
AGR