Protein Info for Dsui_1522 in Dechlorosoma suillum PS

Annotation: serine/threonine protein kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 444 transmembrane" amino acids 333 to 352 (20 residues), see Phobius details PF00069: Pkinase" amino acids 9 to 257 (249 residues), 193 bits, see alignment E=6.6e-61 PF07714: PK_Tyr_Ser-Thr" amino acids 12 to 257 (246 residues), 125 bits, see alignment E=3.5e-40

Best Hits

Predicted SEED Role

"Serine/threonine protein kinase PrkC, regulator of stationary phase" in subsystem Conserved gene cluster associated with Met-tRNA formyltransferase

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QP58 at UniProt or InterPro

Protein Sequence (444 amino acids)

>Dsui_1522 serine/threonine protein kinase (Dechlorosoma suillum PS)
MTIQQLGRYRIDGVLGEGAMGVVYRAFDPLLERVVAIKTIKFDASLSEKESFERRFFREA
KSVARLSHPAIVTLYDAGKAEDVAYMAMEFLEGRELRRFISEAGPLPYTRIADMMAAVAD
GLDYAHRQGVVHRDIKPANLMVLADGAVKITDFGIAQLQTGSKTMTGHMLGTPKYMAPEQ
IMGHPVDGRADIFSLGVVLYQWLTGVAPFDGETVTTIMYRVINEGPVLPTRLMPELPPGF
EAILAKALAKSPEERYQTAGELAADLRRYAELGSPGPVLGLAAQAQPQPRIPPSPSEDPT
MLLAHPFTDTNPLSLSPAPQEAPASPPARRGKALWLGIAAVAIAGGAFALLPTERSAGNG
ATPAPAASTAAPEPQPAARVDLAIAPWGEVVVDGEPKGISPPLESIELLPGHHEVEIRNG
QSEPHRLTLELGAGDTYKIKHKFK