Protein Info for Dsui_1520 in Dechlorosoma suillum PS

Annotation: cytochrome c551/c552

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 105 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF00034: Cytochrom_C" amino acids 26 to 105 (80 residues), 35.3 bits, see alignment E=1.2e-12

Best Hits

Swiss-Prot: 52% identical to CY551_PSEAE: Cytochrome c-551 (nirM) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: None (inferred from 62% identity to mca:MCA2405)

Predicted SEED Role

"Cytochrome c551/c552" in subsystem Soluble cytochromes and functionally related electron carriers

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QP56 at UniProt or InterPro

Protein Sequence (105 amino acids)

>Dsui_1520 cytochrome c551/c552 (Dechlorosoma suillum PS)
MSKSAVIVTGLILAAGLSANLAQASEELAKAKLCVGCHQVSAKVLGPAYKDVAQKYAGVK
TAEADLAKKIRGGSKGVWGGAEMPPNPAISEADATTLAKWILSLK