Protein Info for Dsui_1518 in Dechlorosoma suillum PS

Annotation: putative permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 373 transmembrane" amino acids 29 to 47 (19 residues), see Phobius details amino acids 53 to 71 (19 residues), see Phobius details amino acids 79 to 102 (24 residues), see Phobius details amino acids 170 to 191 (22 residues), see Phobius details amino acids 232 to 251 (20 residues), see Phobius details amino acids 260 to 285 (26 residues), see Phobius details amino acids 292 to 315 (24 residues), see Phobius details amino acids 327 to 355 (29 residues), see Phobius details PF01594: AI-2E_transport" amino acids 36 to 355 (320 residues), 188.4 bits, see alignment E=1.2e-59

Best Hits

KEGG orthology group: None (inferred from 56% identity to eba:ebA7105)

Predicted SEED Role

"Putative permease often clustered with de novo purine synthesis" in subsystem ZZ gjo need homes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QP54 at UniProt or InterPro

Protein Sequence (373 amino acids)

>Dsui_1518 putative permease (Dechlorosoma suillum PS)
MGAGKLLKTRILAQMTEDRPDNRTQRLQALLWLGFAAACVWLLLALSPILTPFLLAAILA
YIGNPATGWLARHRVPRPLAALLVILGLIGALTLLALTLVPLLQKEVGLIAERLPATLTL
LQTKLDPWLQKRLGIDLPLDPASFNALVRKNQDAAQQILGHVLTTLGSSGLALVAFVANL
LLLPVVMFYLLKDWDSLLHRIEDLIPRRFHNLALRLAREVDAVLAEFLRGQLAVMLLLAL
YYSLGLWLAGLEFALPVGLLTGLLIFIPYVGFATGLLLALVAALLQFQGLGLVLAVAIVY
GGGQILESVVLTPWLVGERIGLHPVAVIFALMAFGQLFGFFGILIALPASAALLVGLREL
QRHYKASPFYLNS