Protein Info for Dsui_1515 in Dechlorosoma suillum PS

Annotation: poly(A) polymerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 461 TIGR01942: poly(A) polymerase" amino acids 35 to 446 (412 residues), 503.9 bits, see alignment E=1.7e-155 PF01743: PolyA_pol" amino acids 66 to 191 (126 residues), 128.9 bits, see alignment E=2.3e-41 PF12627: PolyA_pol_RNAbd" amino acids 218 to 279 (62 residues), 70.5 bits, see alignment E=1.2e-23 PF12626: PolyA_pol_arg_C" amino acids 332 to 445 (114 residues), 143.4 bits, see alignment E=5.1e-46

Best Hits

KEGG orthology group: K00970, poly(A) polymerase [EC: 2.7.7.19] (inferred from 75% identity to app:CAP2UW1_2456)

Predicted SEED Role

"Poly(A) polymerase (EC 2.7.7.19)" in subsystem Polyadenylation bacterial (EC 2.7.7.19)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.19

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QP51 at UniProt or InterPro

Protein Sequence (461 amino acids)

>Dsui_1515 poly(A) polymerase (Dechlorosoma suillum PS)
MIRKLISRVFGGKNNAGKSETRNARSGGHGDSAAIIPVKNHGIRREQLSSGARRTVEGLQ
KAGYKAYVVGGAVRDLLAGIPPKDFDVATNATPEQVRACFRRSRIIGRRFQIVHVMMGAE
TLEVTTFRAIHASNAPTDEHGRVLRDNVFGTMAEDAARRDFTVNALYYDPADETIHDYHH
GVADLKQKTLRMIGDPKVRYREDPVRMLRAVRLGAKLNLAIDPAARRPIREMSELIENVP
PARLFDEMLKLLTSGYAVRCVKQLREEGLHHGLLPLLDVILEQPLGERFVMLALANTDER
VQAGKPTSPGFLFATLLWHEVLGQWEKNKANGERPIPALFAAMDEVLDVQAEKLAITRRI
AGDIKDIWALQPRFEARSGKKPYAVLEQPRFKAGYDFLLLRAESGEVDRELGEWWRRFLN
AEGEERQAMLLPEAKGDKKRRRRRKKPAGGGAGAGEGGSGD