Protein Info for Dsui_1510 in Dechlorosoma suillum PS

Annotation: transposase, IS30 family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 386 PF13936: HTH_38" amino acids 60 to 102 (43 residues), 54.5 bits, see alignment 1.1e-18 PF00665: rve" amino acids 232 to 323 (92 residues), 49.2 bits, see alignment E=8.5e-17

Best Hits

Swiss-Prot: 48% identical to INSI1_ECOLI: Transposase InsI for insertion sequence element IS30A (insI1) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 82% identity to pol:Bpro_4334)

MetaCyc: 48% identical to IS30 transposase (Escherichia coli K-12 substr. MG1655)
2.7.7.-

Predicted SEED Role

"Mobile element protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QKI9 at UniProt or InterPro

Protein Sequence (386 amino acids)

>Dsui_1510 transposase, IS30 family (Dechlorosoma suillum PS)
MKYRSRIYYTESQKALMWERWRKGESLQQIAQLFDRNHSSIQRILAETGGIPPRPRCRSR
LALSLAEREEISRGLVAGHSIRSIATLLRRAPSTISREINRNGGQSGYRASQAEQATWDR
ALRPKPCKLAENRTLAHLVADKLQLQWSPEQIAGWLKSAYPGDEDYYVSHETIYRTLFIQ
ARGALKKELLAHLRRTRAMRRSRHHTQKTDNHGRIVGAVSISERPATAEDRAVPGHWEGD
LLCGSGNSQIATLVERQTRYLMLVKIPSKDTETVVAALIKHARKLPQELYKSLTWDRGKE
LADHKQFTLATDIKVFFCDPQSPWQRGSNENTNGLVRQYLPKGIDLSAYSQAKLNAIARR
LNERPRKTLNYETPAQQFYQAVASTG