Protein Info for Dsui_1507 in Dechlorosoma suillum PS

Annotation: transposase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 496 PF02796: HTH_7" amino acids 14 to 38 (25 residues), 24.4 bits, see alignment (E = 2.7e-09) PF00665: rve" amino acids 124 to 231 (108 residues), 38.3 bits, see alignment E=1.4e-13

Best Hits

KEGG orthology group: None (inferred from 63% identity to hna:Hneap_1227)

Predicted SEED Role

"Mobile element protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QP44 at UniProt or InterPro

Protein Sequence (496 amino acids)

>Dsui_1507 transposase (Dechlorosoma suillum PS)
MESFAKLRRRHLVKGESISAIARDLNLSRNTVKKYLKADVGPAYRRQQQPCPKLGAFAEQ
LERWLVQDGLRPKRERRSAKRLFEDLQQAGYAGAYDSVQRFVKQWKGASPGGGTEAFIPL
AFPPGETCQFDWSHEQVELGGVVQTVKLAHFRLCYSRQMFLVAYPRETQEMVLDAHNRAF
AFFGGVPERMVYDNPKTIVQTVLVGKAREFHPRFLALANHYLFEPVACTPASGWEKGQVE
NQVGNVREWCFTPRPAFADLAALNVWLEARCRELAERPHPVEKERSIAQMFAEEQPRLRV
ITALFDGYFEQPCRVSSTCLVAYDRNRYSVPAEFAGQRVSLRAWADRIGVVVDGRVVAEH
ARCFSRERLLLDPWHYLSVLEKKPGALRHGAPFQHWALPAPLAAVKARLMQTPQGDRAFV
EILLALQEHGMERVSVACELALEHRTVTAPVILNHVHRLASPVRPVSQVPTTLTLQTAPA
ANCQRYDALLEVPHAR