Protein Info for Dsui_1505 in Dechlorosoma suillum PS

Annotation: phage-related lysozyme (muraminidase)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 154 PF00959: Phage_lysozyme" amino acids 27 to 146 (120 residues), 113.6 bits, see alignment E=3.9e-37

Best Hits

KEGG orthology group: K01185, lysozyme [EC: 3.2.1.17] (inferred from 96% identity to bmj:BMULJ_00931)

Predicted SEED Role

"macromolecule metabolism; macromolecule degradation; degradation of proteins, peptides, glycopeptides"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.2.1.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QP43 at UniProt or InterPro

Protein Sequence (154 amino acids)

>Dsui_1505 phage-related lysozyme (muraminidase) (Dechlorosoma suillum PS)
MIAVPQAAIDLAKRFEGFHRVPKNEPGRAHPYVCPAGYWTIGYGHLCDPKHPPITETDAE
RYLAADLMTALNATLRYCPVLATEPEKRLAAIVDFTFNLGAGRLQTSTLRRRINQRDWHS
AGQELRRWVYGGGKVLPGLVTRREAEATCLLRAA