Protein Info for Dsui_1503 in Dechlorosoma suillum PS

Annotation: Zn-dependent protease with chaperone function

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 321 transmembrane" amino acids 24 to 43 (20 residues), see Phobius details amino acids 49 to 71 (23 residues), see Phobius details amino acids 170 to 193 (24 residues), see Phobius details amino acids 200 to 218 (19 residues), see Phobius details PF01435: Peptidase_M48" amino acids 81 to 285 (205 residues), 109.8 bits, see alignment E=7.6e-36

Best Hits

KEGG orthology group: K03799, heat shock protein HtpX [EC: 3.4.24.-] (inferred from 97% identity to bmu:Bmul_2307)

Predicted SEED Role

"Peptidase, M48 family"

Isozymes

Compare fitness of predicted isozymes for: 3.4.24.-

Use Curated BLAST to search for 3.4.24.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QP41 at UniProt or InterPro

Protein Sequence (321 amino acids)

>Dsui_1503 Zn-dependent protease with chaperone function (Dechlorosoma suillum PS)
MIRHHPSDLRAALLQHRRLNRLQTGLLILTLVGIAAAAGSLLFGKSGLWLALFAVAGTLL
LEPAAASVLTLRLYRARALYPHEAPEIWALLRELSARAGLSATPVPHYVPSAVVNAFAIG
SKQQASIALTDGLLRNLSSRELAGVLAHEVAHIANEDLRVMGLADSVSRLTSLLAIVGQI
AIVFSLPALLAGAVAVNWPGLLLLAASPQLALLAQLGLSRVREFDADRLAAELTGDPQGL
ASALAKIERVSRSWRAWLWPGWGNPEPSWLRTHPATQDRISRLLTLAPGPATALPFHAPH
FLPESAVTPRPPRWRPSGLWR