Protein Info for Dsui_1502 in Dechlorosoma suillum PS

Annotation: putative membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 166 transmembrane" amino acids 29 to 53 (25 residues), see Phobius details amino acids 69 to 87 (19 residues), see Phobius details amino acids 99 to 118 (20 residues), see Phobius details amino acids 129 to 147 (19 residues), see Phobius details PF06146: PsiE" amino acids 29 to 151 (123 residues), 101.8 bits, see alignment E=1.5e-33

Best Hits

KEGG orthology group: None (inferred from 83% identity to bmu:Bmul_2306)

Predicted SEED Role

"FIG00799023: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QP40 at UniProt or InterPro

Protein Sequence (166 amino acids)

>Dsui_1502 putative membrane protein (Dechlorosoma suillum PS)
MHKESGHTALDEMRSQWRLMTVYERFEQVVVITLSGVMSMVIVISLIQLIRLVFTLLVMD
ALNPLDHKVFQLVFGATMTLLIAMEFKHSIVRVALRRDSIIQVKTVILIGLIALARKFVI
LDPEASPGKIAALAGATLALGATYWLLRERDDRAAKTSEHDPSSSQ