Protein Info for Dsui_1494 in Dechlorosoma suillum PS

Annotation: ATP-dependent metalloprotease FtsH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 609 transmembrane" amino acids 9 to 26 (18 residues), see Phobius details amino acids 106 to 124 (19 residues), see Phobius details PF06480: FtsH_ext" amino acids 9 to 95 (87 residues), 42.8 bits, see alignment E=1e-14 TIGR01241: ATP-dependent metallopeptidase HflB" amino acids 105 to 599 (495 residues), 694 bits, see alignment E=6e-213 PF00004: AAA" amino acids 193 to 326 (134 residues), 148.8 bits, see alignment E=2.5e-47 PF17862: AAA_lid_3" amino acids 349 to 392 (44 residues), 57 bits, see alignment 2.2e-19 PF01434: Peptidase_M41" amino acids 407 to 597 (191 residues), 200.6 bits, see alignment E=4.8e-63

Best Hits

Swiss-Prot: 60% identical to FTSH2_BDEBA: ATP-dependent zinc metalloprotease FtsH 2 (ftsH2) from Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100)

KEGG orthology group: K03798, cell division protease FtsH [EC: 3.4.24.-] (inferred from 97% identity to rpf:Rpic12D_0624)

Predicted SEED Role

"Cell division protein FtsH (EC 3.4.24.-)" in subsystem Bacterial Cell Division (EC 3.4.24.-)

Isozymes

Compare fitness of predicted isozymes for: 3.4.24.-

Use Curated BLAST to search for 3.4.24.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QP32 at UniProt or InterPro

Protein Sequence (609 amino acids)

>Dsui_1494 ATP-dependent metalloprotease FtsH (Dechlorosoma suillum PS)
MEKKDQWNIGYWIVAVLLLLTLQNYWQAAKTVEPVPYSEFEKALAEGRVADVVVADRTVT
GRLKSPDSRGKTTIVATRVEPDLAERLSKYDVPYARAVENTWLRDVLSWILPAVAFFGVW
FFLFRRFAEKQGMGGFLSIGKSRAKVFMEKNTGVTFADVAGVDEAKAELVEIVDFLKNPQ
EYGRLGARIPKGVLLVGPPGTGKTLLAKAVAGEAAVPFFSISGSEFVEMFVGVGAARVRD
LFEQARGQAPAIIFIDELDALGRARGVGGPIGGHDEREQTLNQLLTEMDGFDSSVGLIIL
AATNRPEILDQALLRAGRFDRQVLVDRPDKKGRLDILKVHVKKVTLASDVDLEQVAALTT
GFSGADLANLVNEAALAATRRKARAVKLQDFTAAIERIVAGLEKRNRVLNPKERETVAYH
EMGHALVALALPGTDPVHKISIIPRGIGALGYTLQRPTEDRFLMTRADLEHKIAVLLGGR
AAEKLVFGELSTGAADDLARATDIARDMITRFGMDEGLGYIAFEAQRPRFLDVPELAHGG
CRVAESTQARIDQAIRDIVMGVFERAYRILDTNRAVLERCARELLARETLDENDILQLTQ
GLVLDGNEK