Protein Info for Dsui_1463 in Dechlorosoma suillum PS

Annotation: transcriptional activator of acetoin/glycerol metabolism

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 646 PF01590: GAF" amino acids 79 to 210 (132 residues), 54.2 bits, see alignment E=8.1e-18 PF00989: PAS" amino acids 232 to 297 (66 residues), 24.9 bits, see alignment E=6.2e-09 PF00158: Sigma54_activat" amino acids 335 to 498 (164 residues), 218 bits, see alignment E=2.4e-68 PF14532: Sigma54_activ_2" amino acids 346 to 503 (158 residues), 65.1 bits, see alignment E=2.9e-21 PF07728: AAA_5" amino acids 354 to 474 (121 residues), 24.8 bits, see alignment E=6.6e-09 PF02954: HTH_8" amino acids 601 to 639 (39 residues), 44.2 bits, see alignment 4.5e-15

Best Hits

KEGG orthology group: None (inferred from 60% identity to rfr:Rfer_2864)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QNL3 at UniProt or InterPro

Protein Sequence (646 amino acids)

>Dsui_1463 transcriptional activator of acetoin/glycerol metabolism (Dechlorosoma suillum PS)
MNHPHPRAGAPLLRQARRLFLEQGELPPGLVDERLLRSWHRSRGAGLEPVGRNPETPRLS
EQHLRQALERHQEFVAHAEPVMEYLYAQVQASHSMVVLADNRGLLVHALGDPDFLGKAER
VALAPGASWHEQHRGTNAIGTALAEGAAVEIHGAEHFLERNTFLTCAAAPILDPSGKLLG
ALDISGDHRSHHPHTQGLVRTAAQMIENRLLLSRHRRHIRLHLHPRAEGIGTVAEGVLAL
SEDGWIVGANRAALAMLGLQPADLGATPLERVLDSRSEDLLDWGRRQGQQALLVNTRRGG
RLFLQIHAGKAPIPVGTAAASTPPQDALAALDTGDARLKAALDKARKVAGKPIPLLLHGE
SGVGKELLAQAIHRSSPRREGPFVAVNCAALPENLIEAELFGYAPGAFSGARKEGSPGRL
REAHGGTLFLDEIGDMPLNLQSRLLRVLQERQVTPLGSGKPVAVDFALVCATHRPLRQEV
EAGRFRADLYYRLNGLTLTLPALRERSDFSALVARLLAEMAPGRSLALAPAVARAFADYA
WPGNLRQLANALRTATALLEADEECIDWPHLPDDLAEELQQRPLAADAAATMAEPAPDRL
QEVSRLAIQRAVAAARGNLSEAARRLGISRNTLYRKLKAGAAGEVS