Protein Info for Dsui_1453 in Dechlorosoma suillum PS

Annotation: metal-dependent hydrolase, beta-lactamase superfamily III

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 257 PF23023: Anti-Pycsar_Apyc1" amino acids 1 to 189 (189 residues), 28.9 bits, see alignment E=2e-10 PF00753: Lactamase_B" amino acids 21 to 167 (147 residues), 35.8 bits, see alignment E=1.6e-12 PF12706: Lactamase_B_2" amino acids 27 to 224 (198 residues), 64 bits, see alignment E=3e-21 PF02112: PDEase_II" amino acids 47 to 110 (64 residues), 37.3 bits, see alignment E=3.6e-13

Best Hits

KEGG orthology group: None (inferred from 69% identity to app:CAP2UW1_0661)

Predicted SEED Role

"CAMP phosphodiesterases class-II:Metallo-beta-lactamase superfamily" in subsystem cAMP signaling in bacteria

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QNK3 at UniProt or InterPro

Protein Sequence (257 amino acids)

>Dsui_1453 metal-dependent hydrolase, beta-lactamase superfamily III (Dechlorosoma suillum PS)
MKIRILGCSGGIGGRHLRTTSMLVDHDVLVDAGTGVADLSLAELGAIDHIFLTHSHLDHI
ASLPLLIDTVMDMRIGRPVTVHASEATLAILRQHVFNWLVWPDFSEIPSREAPCLQFQAM
ELGQRVDLGCGRSITALPAEHTVPAVGYLLDSGSNSLAFSGDTTSNDSFWPRVNEVANLR
YLIIETAFSNKERALAIASKHLCPSLLAEELAKLARPAEVFITHLKPGQIEQTMQEIEEG
VAGFKPRMLQNNQVFEL