Protein Info for Dsui_1442 in Dechlorosoma suillum PS

Annotation: putative efflux protein, MATE family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 454 transmembrane" amino acids 25 to 48 (24 residues), see Phobius details amino acids 56 to 81 (26 residues), see Phobius details amino acids 95 to 117 (23 residues), see Phobius details amino acids 137 to 158 (22 residues), see Phobius details amino acids 168 to 189 (22 residues), see Phobius details amino acids 202 to 220 (19 residues), see Phobius details amino acids 249 to 272 (24 residues), see Phobius details amino acids 284 to 305 (22 residues), see Phobius details amino acids 324 to 345 (22 residues), see Phobius details amino acids 357 to 375 (19 residues), see Phobius details amino acids 394 to 414 (21 residues), see Phobius details amino acids 426 to 449 (24 residues), see Phobius details TIGR00797: MATE efflux family protein" amino acids 26 to 427 (402 residues), 226.3 bits, see alignment E=3e-71 PF01554: MatE" amino acids 26 to 184 (159 residues), 93.6 bits, see alignment E=5.5e-31 amino acids 252 to 411 (160 residues), 80.7 bits, see alignment E=5e-27

Best Hits

Swiss-Prot: 53% identical to NORM_AROAE: Probable multidrug resistance protein NorM (norM) from Aromatoleum aromaticum (strain EbN1)

KEGG orthology group: K03327, multidrug resistance protein, MATE family (inferred from 60% identity to app:CAP2UW1_2788)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QNJ2 at UniProt or InterPro

Protein Sequence (454 amino acids)

>Dsui_1442 putative efflux protein, MATE family (Dechlorosoma suillum PS)
MTASVPAPAAPRLGEEIRHIARHAWPILVAQLASMGLMLIDTALLGHYGAADLAAVAIGG
GIYIAVIMACAGVLQAVAPVVAHLHGAGRHGEIAAALQQAFWVALVLAVPACLLMRFPDP
LLAMATMEPAVEAKTRAYLDLLAWGLPLVLLYRTLFAFANALGHSRPFMLISLATTALHL
PLSWCLIQGRWGGPPLGVEGTGWSTLIIVGVGFFCGFAYLRRSAALAPLALLGRWHRPQW
VRLRELLRLGLPMGFSNLVEISAFTLIALFIAREGATVVAGHRIVANLAALLYMLPLAVA
IATLARVGRAAGARDQAGMERAVGAGMVLATGLSLLFGGLLWWGAGPLVGAATGDGRVAA
VAVGLVGYLAAYQLFDAIQTVAGFSLRGCKITFLPMLIHTLCFWGVGLGGGWWLAYGSPA
MGVAGYWAASTASLVLAAVLLGGLLWRVLAATRE