Protein Info for Dsui_1440 in Dechlorosoma suillum PS

Annotation: response regulator with CheY-like receiver domain and winged-helix DNA-binding domain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 121 PF00072: Response_reg" amino acids 4 to 116 (113 residues), 92.8 bits, see alignment E=8.1e-31

Best Hits

Swiss-Prot: 37% identical to CHEY_ENTCL: Chemotaxis protein CheY (cheY) from Enterobacter cloacae

KEGG orthology group: K03413, two-component system, chemotaxis family, response regulator CheY (inferred from 88% identity to azo:azo0411)

Predicted SEED Role

"Chemotaxis regulator - transmits chemoreceptor signals to flagelllar motor components CheY" in subsystem Bacterial Chemotaxis or Flagellar motility or Two-component regulatory systems in Campylobacter

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QNJ0 at UniProt or InterPro

Protein Sequence (121 amino acids)

>Dsui_1440 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain (Dechlorosoma suillum PS)
MKTIFLVDDSATILLSISNILAKAGYAVEKAGNAEEGMKKFQAGVKVDLLITDLNMPGMN
GIQFIREVRKLPNYKFMPILFLTTESQQEKRAEAKAAGASGWIVKPATADQLLNTIKLVL
R