Protein Info for Dsui_1434 in Dechlorosoma suillum PS

Annotation: methylase of chemotaxis methyl-accepting protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 270 PF03705: CheR_N" amino acids 10 to 60 (51 residues), 58.2 bits, see alignment 1.3e-19 PF01739: CheR" amino acids 77 to 264 (188 residues), 195.2 bits, see alignment E=2.1e-61 PF08241: Methyltransf_11" amino acids 174 to 246 (73 residues), 21.4 bits, see alignment E=7.9e-08

Best Hits

Swiss-Prot: 43% identical to CHER_ECOLI: Chemotaxis protein methyltransferase (cheR) from Escherichia coli (strain K12)

KEGG orthology group: K00575, chemotaxis protein methyltransferase CheR [EC: 2.1.1.80] (inferred from 67% identity to dar:Daro_1146)

MetaCyc: 43% identical to chemotaxis protein methyltransferase (Escherichia coli K-12 substr. MG1655)
Protein-glutamate O-methyltransferase. [EC: 2.1.1.80]; 2.1.1.- [EC: 2.1.1.80]

Predicted SEED Role

"Chemotaxis protein methyltransferase CheR (EC 2.1.1.80)" in subsystem Bacterial Chemotaxis (EC 2.1.1.80)

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.80

Use Curated BLAST to search for 2.1.1.80

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QNI4 at UniProt or InterPro

Protein Sequence (270 amino acids)

>Dsui_1434 methylase of chemotaxis methyl-accepting protein (Dechlorosoma suillum PS)
MDGPSGISDQEFGRFRDLIYQIAGIQLSDAKKVLLVGRLSRRLKHYGLSTFAQYYQLVTS
PQESRELQTMVDLLTTNETYFFREPKHFDYLAQEILPHKAKPGVPFNIWSAACSSGEEPY
TLAMVLAEHLGNRPWQVVGSDISTVVLAKAQAGHYPLERTEGIPPQYLKKYCLKGVRSQE
GTLLVAKELRERVRFLQVNLTKPAPDLGPFDVIFLRNVMIYFDMETKRKVVENLITRLKP
GGTFIVGHSESLNGITDRLKCLRPTIYEKP