Protein Info for Dsui_1430 in Dechlorosoma suillum PS

Annotation: PAS domain S-box/diguanylate cyclase (GGDEF) domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 328 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF00989: PAS" amino acids 14 to 118 (105 residues), 26.2 bits, see alignment E=1e-09 TIGR00229: PAS domain S-box protein" amino acids 14 to 139 (126 residues), 32.9 bits, see alignment E=6.2e-12 PF08448: PAS_4" amino acids 18 to 133 (116 residues), 37.1 bits, see alignment E=4.9e-13 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 146 to 315 (170 residues), 181.2 bits, see alignment E=1.3e-57 PF00990: GGDEF" amino acids 151 to 311 (161 residues), 182.8 bits, see alignment E=6.3e-58

Best Hits

KEGG orthology group: None (inferred from 42% identity to gca:Galf_2226)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QNI0 at UniProt or InterPro

Protein Sequence (328 amino acids)

>Dsui_1430 PAS domain S-box/diguanylate cyclase (GGDEF) domain-containing protein (Dechlorosoma suillum PS)
MGHPHLAAPLLLELAHTVNAGLILIDAEGKVQLWNRWLAERSGVSAQEIQGRRLEEVFPH
LANSRLAHAVQTALQQQLPAILSQTLNRRPFPLQDHLHNDAHPIEQAITIAPLARESGHI
HCLIQIQDVTAAVRREQQLREQAQQLQALSNIDGLTGVANRRSFDARFQEEFQRAQRHGS
DISVLMLDIDYFKEYNDCYGHQAGDTCLTVVANTLRRCLQRGGDFVARYGGEEFAVVLPG
ASHGAACKLASSLQQEISRLGIPHANSHAASHLSISVGVATHTPQRNDRAQDLLRGADIA
LYQAKRQGRNRVVSADALDLTVQPEKLM