Protein Info for Dsui_1428 in Dechlorosoma suillum PS

Annotation: 2-keto-4-pentenoate hydratase/2-oxohepta-3-ene-1,7-dioic acid hydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01557: FAA_hydrolase
  • amino acids 27 to 237 (211 residues), 169.1 bits, E=5.9e-54

Best Hits

Swiss-Prot: 35% identical to FAHD1_ARATH: Probable acylpyruvase FAHD1, mitochondrial (FAHD1) from Arabidopsis thaliana

KEGG orthology group: None (inferred from 67% identity to app:CAP2UW1_4048)

MetaCyc: 55% identical to 3-fumarylpyruvate hydrolase (Bradyrhizobium sp. JS329)
RXN-10445 [EC: 3.7.1.20]

Predicted SEED Role

"Fumarylacetoacetate hydrolase family protein" in subsystem Gentisare degradation or Salicylate and gentisate catabolism

MetaCyc Pathways

• gentisate degradation I (1/3 steps found)
• 5-nitroanthranilate degradation (2/6 steps found)
• 3-phenylpropanoate degradation (4/10 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.7.1.20

Sequence Analysis Tools

See G8QNH8 at UniProt or InterPro

Protein Sequence (238 amino acids)

>Dsui_1428 2-keto-4-pentenoate hydratase/2-oxohepta-3-ene-1,7-dioic acid hydratase (Dechlorosoma suillum PS)
MDYLFTPPPVVALAIAGSQARFPVRRVYCVGRNYADHAREMGADTREPPFFFSKPADALV
PVADGSAATVAYPPATNNLQHEVELVVALGPRIAELGQRGLNVPVAAALEGVFGYAVGFD
LTRRDQQQKAKEKAHPWDMGKGFDQSGPIGAIVPAAQAGHPASGAIWLEVNGERRQSGDL
AQMSWNVAEVVANLSTFLRLAPGDLIFTGTPAGVSTVVRGDTLVGGVEGIGRLAVTLA