Protein Info for Dsui_1419 in Dechlorosoma suillum PS

Annotation: phosphoribosyl-AMP cyclohydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 135 PF01502: PRA-CH" amino acids 37 to 111 (75 residues), 116.8 bits, see alignment E=1.4e-38

Best Hits

Swiss-Prot: 72% identical to HIS3_DECAR: Phosphoribosyl-AMP cyclohydrolase (hisI) from Dechloromonas aromatica (strain RCB)

KEGG orthology group: K01496, phosphoribosyl-AMP cyclohydrolase [EC: 3.5.4.19] (inferred from 72% identity to dar:Daro_3378)

Predicted SEED Role

"Phosphoribosyl-AMP cyclohydrolase (EC 3.5.4.19)" in subsystem Histidine Biosynthesis (EC 3.5.4.19)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.4.19

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QNG9 at UniProt or InterPro

Protein Sequence (135 amino acids)

>Dsui_1419 phosphoribosyl-AMP cyclohydrolase (Dechlorosoma suillum PS)
MSHDLDPSLSWLDALKFGADGTIPVIAQDAASGRVIMFAYANRETLAETARTGRATYWSR
SRNKVWRKGEESGHFQHVKEMRADCDGDVVLLSVEQEGGIACHTGRESCFFYRREGDRWI
PADPVLKDPKEIYAK