Protein Info for Dsui_1413 in Dechlorosoma suillum PS

Annotation: chromate transport protein ChrA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 173 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details transmembrane" amino acids 72 to 94 (23 residues), see Phobius details amino acids 114 to 143 (30 residues), see Phobius details amino acids 155 to 172 (18 residues), see Phobius details PF02417: Chromate_transp" amino acids 6 to 169 (164 residues), 126 bits, see alignment E=7.8e-41

Best Hits

KEGG orthology group: K07240, chromate transporter (inferred from 63% identity to dar:Daro_3385)

Predicted SEED Role

"Chromate transport protein ChrA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QNG3 at UniProt or InterPro

Protein Sequence (173 amino acids)

>Dsui_1413 chromate transport protein ChrA (Dechlorosoma suillum PS)
MSLLADLFFQFALLFCVAFGGASALLPEMHRVVVLEKHWLDDATFTHLYAIAQAAPGPNG
LVVSLIGWEVAGVPGALAASLGMVLPTGIMIYLLMQHWHRFAGARWQQSVQLGVAPLAVG
LVFAAAFLIGQAAGLGWGGVLLAGLTAAALLKTKWHPLWLIGLGGVAGLLGWV